Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: soltu-3epoxy

Solanum tuberosum (Potato) StEH1 Lemhi Russet clone EH10.1 epoxide hydrolase

Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Solanum tuberosum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Solanales: N E > Solanaceae: N E > Solanoideae: N E > Solaneae: N E > Solanum: N E > Solanum tuberosum: N E


Molecular evidence
Database
No mutation
7 structures (e.g. : 2CJP, 3CXU, 4UFN... more)
No kinetic





No Substrate
2 inhibitors: Tetraethylene-glycol, Valpromide
1 Genbank : U02497
1 Ncbi-nid : 407943
1 Ncbi-pid : 407944
>3 Structure links 4 more: 3CXU, 4UHB, 4UFN
1 UniProt : Q41415
1 Interpro : Q41415
1 Prodom : Q41415
1 Pfam : Q41415
1 PIRSF : Q41415
1 SUPERFAM : Q41415
Sequence
Graphical view for this peptide sequence: soltu-3epoxy
Colored MSA for Epoxide_hydrolase (raw)
MEKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAER
GYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVF
VVAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIYG
EDHYISRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPFYFPKGKGLEAI
PDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWTG
AQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAH
FVSQERPHEISKHIYDFIQKF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAER
GYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVF
VVAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIYG
EDHYISRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPFYFPKGKGLEAI
PDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWTG
AQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAH
FVSQERPHEISKHIYDFIQKF


References
8 more
    Title: Conformational diversity and enantioconvergence in potato epoxide hydrolase 1
    Bauer P, Carlsson AJ, Amrein BA, Dobritzsch D, Widersten M, Kamerlin SC
    Ref: Org Biomol Chem, 14:5639, 2016 : PubMed

            

    Title: Laboratory-Evolved Enzymes Provide Snapshots of the Development of Enantioconvergence in Enzyme-Catalyzed Epoxide Hydrolysis
    Janfalk Carlsson A, Bauer P, Dobritzsch D, Nilsson M, Kamerlin SC, Widersten M
    Ref: Chembiochem, 17:1693, 2016 : PubMed

            

    Title: Cloning and expression of soluble epoxide hydrolase from potato
    Stapleton A, Beetham JK, Pinot F, Garbarino JE, Rockhold DR, Friedman M, Hammock BD, Belknap WR
    Ref: Plant J, 6:251, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer