Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: solus-q43s18

Solibacter usitatus Ellin6076 homoserine o-acetyltransferase like

Relationship
Family|Homoserine_transacetylase_like_est
Block| X
Position in NCBI Life Tree|Solibacter usitatus Ellin6076
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Acidobacteria: N E > Solibacteres: N E > Solibacterales: N E > Solibacteraceae: N E > Candidatus Solibacter: N E > Candidatus Solibacter usitatus: N E > Candidatus Solibacter usitatus Ellin6076: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AAIA01000048, WP_011686334, ABJ85581
1 UniProt : Q01XN4
1 Interpro : Q01XN4
1 Pfam : Q01XN4
1 PIRSF : Q01XN4
1 SUPERFAM : Q01XN4
Sequence
Graphical view for this peptide sequence: solus-q43s18
Colored MSA for Homoserine_transacetylase_like_est (raw)
MKALVLLILCRAAIAQSPVTPERHEFIISDFHTESGATLPQARIVYGTYG
HLNADHSNAVLLPSHYMANLRGYEWLIGSGKALDPAQLFLITSELFGNGS
SSSPSNTPEPFHGPRFPVMTIRDNVEAVHRLLTEDLKVTHLRAVIGFSMG
AQQAFQWAVSYPDFADRIVATSGTAKTYPHGIVRLEGQIAALTADAAFLN
GDYTSPPKKGLEAFGMVWAAWLYSQEWWRRELWRASSPAGTTFEQVSNRF
RTRFNADANDYILQARTWQHHDVGATPGFSGDTERALRSIKVPLLYMPSE
TDLYFPVGDARFEAPFIPKVTLMPIPSLWGHTAGAASNPADAKFLNENIA
KFLLIGRQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKALVLLILCRAAIAQSPVTPERHEFIISDFHTESGATLPQARIVYGTYG
HLNADHSNAVLLPSHYMANLRGYEWLIGSGKALDPAQLFLITSELFGNGS
SSSPSNTPEPFHGPRFPVMTIRDNVEAVHRLLTEDLKVTHLRAVIGFSMG
AQQAFQWAVSYPDFADRIVATSGTAKTYPHGIVRLEGQIAALTADAAFLN
GDYTSPPKKGLEAFGMVWAAWLYSQEWWRRELWRASSPAGTTFEQVSNRF
RTRFNADANDYILQARTWQHHDVGATPGFSGDTERALRSIKVPLLYMPSE
TDLYFPVGDARFEAPFIPKVTLMPIPSLWGHTAGAASNPADAKFLNENIA
KFLLIGRQ



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer