Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sorce-EPOF

Sorangium cellulosum (Polyangium cellulosum) epof

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Polyangium cellulosum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > delta/epsilon subdivisions: N E > Deltaproteobacteria: N E > Myxococcales: N E > Sorangiineae: N E > Polyangiaceae: N E > Sorangium: N E > Sorangium cellulosum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF217189
1 UniProt : Q9KIZ5
1 Interpro : Q9KIZ5
1 Prodom : Q9KIZ5
1 Pfam : Q9KIZ5
1 PIRSF : Q9KIZ5
1 SUPERFAM : Q9KIZ5
Sequence
Graphical view for this peptide sequence: sorce-EPOF
Colored MSA for Thioesterase (raw)
ARLFCFHGSGGSPEGFRSWSEKSEWSDLEIVAMWHDRSLASEDAPGKKYV
QEAASLIQHYADAPFALVGFSLGVRFVMGTAVELASRSGAPAPLAVFALG
GSLISSSEITPEMETDIIAKLFFRNAAGFVRSTQQVQADARADKVITDTM
VAPAPGDSKEPPSKIAVPIVAIAGSDDVIVPPSDVQDLQSRTTERFYMHL
LPGDHEFLVDRGREIMHIVDSHLNPLLAARTTSSGPAFEAK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ARLFCFHGSGGSPEGFRSWSEKSEWSDLEIVAMWHDRSLASEDAPGKKYV
QEAASLIQHYADAPFALVGFSLGVRFVMGTAVELASRSGAPAPLAVFALG
GSLISSSEITPEMETDIIAKLFFRNAAGFVRSTQQVQADARADKVITDTM
VAPAPGDSKEPPSKIAVPIVAIAGSDDVIVPPSDVQDLQSRTTERFYMHL
LPGDHEFLVDRGREIMHIVDSHLNPLLAARTTSSGPAFEAK


References
    Title: Isolation and characterization of the epothilone biosynthetic gene cluster from Sorangium cellulosum
    Julien B, Shah S, Ziermann R, Goldman R, Katz L, Khosla C
    Ref: Gene, 249:153, 2000 : PubMed

            

    Title: Cloning and heterologous expression of the epothilone gene cluster
    Tang L, Shah S, Chung L, Carney J, Katz L, Khosla C, Julien B
    Ref: Science, 287:640, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer