Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: soybn-c6tas4

Glycine max (Soybean) (Glycine hispida) Uncharacterized protein

Relationship
Family|Ndr_family
Block| X
Position in NCBI Life Tree|Glycine max
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Fabales: N E > Fabaceae: N E > Papilionoideae: N E > Phaseoleae: N E > Glycine: N E > Soja: N E > Glycine max: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : BT094616
1 UniProt : C6TAS4
1 UniProt : C6TAS4
1 Interpro : C6TAS4
1 Pfam : C6TAS4
1 PIRSF : C6TAS4
1 SUPERFAM : C6TAS4
Sequence
Graphical view for this peptide sequence: soybn-c6tas4
Colored MSA for Ndr_family (raw)
MGESSDSVSIDIDLIPLGGKECTVKTSKGSMSVLVCGDREKPALITYPDV
ALNYVSCFQGLLFCPEAASLLLHNFCIYHIDAPGHELGADVISSDEPLLC
VDDLADQIAEVLDFFGLREVLCLGVTAGAYVLTLLAMKYKERVLGLILVS
PICKSPSWTEWLYNKVLMNLLYFYGMCGVLKECLLQRYFSKELRCSVQGA
ESDIILTCRRLLDERQGLNVMRFLQAINARHDLTEGLKDLQCKTLIFAGE
SSPFHAESVYMSSKMNHKICALVEVQACGSLVTEEHPNSMITPLERFLMG
FGYHRQTHAASSSSNGSNPASPTSHSCIAPELLSPESLGIKLKPIRTRVD
VQI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGESSDSVSIDIDLIPLGGKECTVKTSKGSMSVLVCGDREKPALITYPDV
ALNYVSCFQGLLFCPEAASLLLHNFCIYHIDAPGHELGADVISSDEPLLC
VDDLADQIAEVLDFFGLREVLCLGVTAGAYVLTLLAMKYKERVLGLILVS
PICKSPSWTEWLYNKVLMNLLYFYGMCGVLKECLLQRYFSKELRCSVQGA
ESDIILTCRRLLDERQGLNVMRFLQAINARHDLTEGLKDLQCKTLIFAGE
SSPFHAESVYMSSKMNHKICALVEVQACGSLVTEEHPNSMITPLERFLMG
FGYHRQTHAASSSSNGSNPASPTSHSCIAPELLSPESLGIKLKPIRTRVD
VQI


Reference
    Title: Genome sequence of the palaeopolyploid soybean
    Schmutz J, Cannon SB, Schlueter J, Ma J, Mitros T, Nelson W, Hyten DL, Song Q, Thelen JJ and Jackson SA <35 more author(s)>
    Ref: Nature, 463:178, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer