Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sphs1-OPH

Sphingopyxis sp. (strain 113P3) Oxidized polyvinyl alcohol hydrolase

Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Pseudomonas sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas sp.: N E


Molecular evidence
Database
No mutation
1 structure:
3WLA: Crystal Structure of sOPH Native (Sphingopyxis sp. Oxidized polyvinyl alcohol hydrolase (OPH))
No kinetic





No Substrate
No inhibitor
1 Genbank : AB190288
1 Structure : 3WLA
1 UniProt : Q588Z2
1 Interpro : Q588Z2
1 Prodom : Q588Z2
1 Pfam : Q588Z2
1 PIRSF : Q588Z2
1 SUPERFAM : Q588Z2
Sequence
Graphical view for this peptide sequence: sphs1-OPH
Colored MSA for AlphaBeta_hydrolase (raw)
MFKPVVKSRSSRSFCYLAGCLAMVAATLSSTAQAKSEWACPEGFTPKAGL
NTDFPSDGKKRAFVVVPPKDSAGGAPVWVPMVGTVEATNWNLNVPRSGNN
AKLAEHGYMVISPVRQCAEQDPNLGAGACNGVGKDGWTWNPWNDGRAPDA
SGDKYKTDAGDDVRFLEAMVRCVGTKWKLDRKRLFLGGISAGGTMTNRAL
LFDSEFWAGGMPISGEWYSTKDDGSTVPFQETRKMVAAAPAKIWQGRVGP
YPLPSKLDPMVVITVWGGEKDLWDCGPPLGLCSDYRPTTQASSNYFSSIS
NVVHVACSATHGHMWPQVNTDAFNLWALNTMASHPKGSSPKDFKLTAPPE
GYSCKIGRFTDHYK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFKPVVKSRSSRSFCYLAGCLAMVAATLSSTAQAKSEWACPEGFTPKAGL
NTDFPSDGKKRAFVVVPPKDSAGGAPVWVPMVGTVEATNWNLNVPRSGNN
AKLAEHGYMVISPVRQCAEQDPNLGAGACNGVGKDGWTWNPWNDGRAPDA
SGDKYKTDAGDDVRFLEAMVRCVGTKWKLDRKRLFLGGISAGGTMTNRAL
LFDSEFWAGGMPISGEWYSTKDDGSTVPFQETRKMVAAAPAKIWQGRVGP
YPLPSKLDPMVVITVWGGEKDLWDCGPPLGLCSDYRPTTQASSNYFSSIS
NVVHVACSATHGHMWPQVNTDAFNLWALNTMASHPKGSSPKDFKLTAPPE
GYSCKIGRFTDHYK


References
    Title: Structural insights into enzymatic degradation of oxidized polyvinyl alcohol
    Yang Y, Ko TP, Liu L, Li J, Huang CH, Chan HC, Ren F, Jia D, Wang AH and Du G <2 more author(s)>
    Ref: Chembiochem, 15:1882, 2014 : PubMed

            

    Title: Roles of tryptophan residue and disulfide bond in the variable lid region of oxidized polyvinyl alcohol hydrolase
    Yang Y, Ko TP, Liu L, Li J, Huang CH, Chen J, Guo RT, Du G
    Ref: Biochemical & Biophysical Research Communications, 452:509, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer