Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sphww-a5j2a5

Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Meta-cleavage pathway hydrolase protein

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Sphingomonas wittichii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Sphingomonadales: N E > Sphingomonadaceae: N E > Sphingomonas: N E > Sphingomonas wittichii: N E


Molecular evidence
Database
No mutation
5 structures (e.g. : 4LXG, 4LXH, 4LXI... more)
No kinetic





3 substrates: HOPDA, HOPDA-3-Cl, HOPDA-5,8-diF
No inhibitor
2 Genbank : DQ975235, CP000699
2 UniProt : A5J2A5, A5VAT9
>3 Structure links 2 more: 4LXG, 4LXH, 4LXI
2 UniProt : A5J2A5, A5VAT9
2 Interpro : A5J2A5, A5VAT9
2 Prodom : A5J2A5, A5VAT9
2 Pfam : A5J2A5, A5VAT9
2 PIRSF : A5J2A5, A5VAT9
2 SUPERFAM : A5J2A5, A5VAT9
Sequence
Graphical view for this peptide sequence: sphww-a5j2a5
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MFEQFESKFIDCDGIRTHYIEMGEGDPLVLVHGGGAGADGRSNFADNFPI
FARHMRVIAYDMVGFGQTDAPDPAGFAYTQAARTDHLISFIKALGLSKIC
LIGNSMGGTTACGAALKAPELIDRLVLMGAAVNISPDDMVANRDDLAAVM
SYDGSEEGMRKIIAALTHSYQPTDDIVHYRHEASLRPTTTAAYKATMGWA
KQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIPQAQAIGH
VFPNCGHWVMIEYPEEFCTQTLHFFGKLD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFEQFESKFIDCDGIRTHYIEMGEGDPLVLVHGGGAGADGRSNFADNFPI
FARHMRVIAYDMVGFGQTDAPDPAGFAYTQAARTDHLISFIKALGLSKIC
LIGNSMGGTTACGAALKAPELIDRLVLMGAAVNISPDDMVANRDDLAAVM
SYDGSEEGMRKIIAALTHSYQPTDDIVHYRHEASLRPTTTAAYKATMGWA
KQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIPQAQAIGH
VFPNCGHWVMIEYPEEFCTQTLHFFGKLD


References
    Title: The Lid Domain of the MCP Hydrolase DxnB2 Contributes to the Reactivity toward Recalcitrant PCB Metabolites
    Ruzzini AC, Bhowmik S, Yam KC, Ghosh S, Bolin JT, Eltis LD
    Ref: Biochemistry, 52:5685, 2013 : PubMed

            

    Title: A substrate-assisted mechanism of nucleophile activation in a ser-his-asp containing C-C bond hydrolase
    Ruzzini AC, Bhowmik S, Ghosh S, Yam KC, Bolin JT, Eltis LD
    Ref: Biochemistry, 52:7428, 2013 : PubMed

            

    Title: Characterization of a C-C bond hydrolase from Sphingomonas wittichii RW1 with novel specificities towards polychlorinated biphenyl metabolites
    Seah SY, Ke J, Denis G, Horsman GP, Fortin PD, Whiting CJ, Eltis LD
    Ref: Journal of Bacteriology, 189:4038, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer