Gene_locus Report for: sphww-a5v570Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) 4-carboxymuconolactone decarboxylase / 3-oxoadipate enol-lactonase Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Sphingomonadales: N E > Sphingomonadaceae: N E > Sphingomonas: N E > Sphingomonas wittichii: N E
6_AlphaBeta_hydrolase : sphww-a5v4n7Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5v4r1Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5v5p4Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5v6j3Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5v6l9Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5v6v0Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5ve59Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5ve60Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5vgi4Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Putative uncharacterized protein. A85-EsteraseD-FGH : sphww-a5v5h7Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) S-formylglutathione hydrolase. A85-IroE-IroD-Fes-Yiel : sphww-a5ve31Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Putative esterase. Bacterial_esterase : sphww-a5v7g3Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Putative uncharacterized protein. Carbon-carbon_bond_hydrolase : sphww-a5j2a5 Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Meta-cleavage pathway hydrolase protein, sphww-a5v7c2Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5v750Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5vbl8Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5ve07Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5ve07Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273). Alpha/beta hydrolase fold. Carboxymethylbutenolide_lactonase : sphww-a5v4x9Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) 3-oxoadipate enol-lactonase, sphww-a5vh68Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) 3-oxoadipate enol-lactonase. Carboxypeptidase_S10 : sphww-a5vcv2Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Peptidase S10, serine carboxypeptidase. Carb_B_Bacteria : sphww-a5v5e8Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) carboxylesterase, type b, sphww-a5v5h0Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) carboxylesterase, type b, sphww-a5v6r6Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) carboxylesterase, type b, sphww-a5ve47Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) carboxylesterase, type b precursor, sphww-a5ve90Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) carboxylesterase, type b. Duf_3089 : sphww-a5v3v2Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Putative uncharacterized protein. Epoxide_hydrolase : sphww-a5v693Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5v737Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5vbi9Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5vbj1Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5ve39Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold, sphww-a5ve53Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold. Est-OsmC : sphww-a5v4y0Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) esterase found in n-term of an OsmC/Ohr family domain. HNLyase_Bact : sphww-a5v7k1Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Putative uncharacterized protein, sphww-a5v509Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Alpha/beta hydrolase fold. Proline_iminopeptidase : sphww-a5v4t8Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273). Prolyl aminopeptidase, sphww-a5ven2Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273). Proline iminopeptidase. VirJ : sphww-a5vfs1Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273). Virulence factor family protein, sphww-a5vfs2Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273). Type IV secretory pathway VirJ component-like protein, sphww-a5vgg0Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273). Type IV secretory pathway VirJ component-like protein
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: sphww-a5v570 Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MAFTLRGDVRLHWRLDGSDERPPLVLLNSIGTDISLWDRTVPHLLPTFRL
LRIDVRGHGASDAPAGDYDLAMLADDVAAVMDDAGIAVAPVAGVSLGGMI
AMEIALRHPDKVAALALICTSGAMDPAAWAARVDAVRDGGTGAIADMAIE
RFLSSDFIVRHPEIAESLKRAIRAQADDGYVGAAAAIRDMALADRIGAIA
VPTLVVTGAVDISTPYEGHGDRLVHSIPGAVRAVVAGAHLPPIEAPGQLA
ARIQSFL
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MAFTLRGDVRLHWRLDGSDERPPLVLLNSIGTDISLWDRTVPHLLPTFRL LRIDVRGHGASDAPAGDYDLAMLADDVAAVMDDAGIAVAPVAGVSLGGMI AMEIALRHPDKVAALALICTSGAMDPAAWAARVDAVRDGGTGAIADMAIE RFLSSDFIVRHPEIAESLKRAIRAQADDGYVGAAAAIRDMALADRIGAIA VPTLVVTGAVDISTPYEGHGDRLVHSIPGAVRAVVAGAHLPPIEAPGQLA ARIQSFL
|
|
|