Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: staau-SA2367

Staphylococcus aureus putative hydrolase FphE

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Staphylococcus aureus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Staphylococcaceae: N E > Staphylococcus: N E > Staphylococcus aureus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 71 more: ACKC01000009, ACKG01000018, ACYO01000011
>3 UniProt links 6 more: Q6G693, Q99R57, Q8NUP5
>3 UniProt links 6 more: Q99R57, Q8NUP5, Q6G693
>3 Interpro links 6 more: Q99R57, Q8NUP5, Q6G693
>3 Prodom links 6 more: Q99R57, Q8NUP5, Q6G693
>3 Pfam links 6 more: Q99R57, Q8NUP5, Q6G693
>3 PIRSF links 6 more: Q99R57, Q8NUP5, Q6G693
>3 SUPERFAM links 6 more: Q99R57, Q8NUP5, Q6G693
Sequence
Graphical view for this peptide sequence: staau-SA2367
Colored MSA for 6_AlphaBeta_hydrolase (raw)
METLELQGAKLRYHQVGQGPVLIFIPGANGTGNIFLPLAEQLKDHFTVVA
VDRRDYGESELTEPLPDSASNPDSDYRVKRDAQDIAELAKSLSDEPVYIL
GSSSGSIVAMHVLKDYPEVVKKIAFHEPPINTFLPDSTYWKDKNDDIVHQ
ILTEGLEKGMKTFGETLNIAPIDAKMMSQPADTEEGRIEQYKRTMFWSEF
EIRQYTHSDITLDDFTKYSDKITLLNGTDSRGSFPQDVNFYINKETGIPI
VDIPGGHLGYIQKPEGFADVLLNMWG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

METLELQGAKLRYHQVGQGPVLIFIPGANGTGNIFLPLAEQLKDHFTVVA
VDRRDYGESELTEPLPDSASNPDSDYRVKRDAQDIAELAKSLSDEPVYIL
GSSSGSIVAMHVLKDYPEVVKKIAFHEPPINTFLPDSTYWKDKNDDIVHQ
ILTEGLEKGMKTFGETLNIAPIDAKMMSQPADTEEGRIEQYKRTMFWSEF
EIRQYTHSDITLDDFTKYSDKITLLNGTDSRGSFPQDVNFYINKETGIPI
VDIPGGHLGYIQKPEGFADVLLNMWG


References
25 more
    Title: Newly discovered Staphylococcus aureus serine hydrolase probe and drug targets
    Fellner M
    Ref: ADMET & DMPK, 10:107, 2022 : PubMed

            

    Title: Structural basis for the inhibitor and substrate specificity of the unique Fph serine hydrolases of Staphylococcus aureus
    Fellner M, Lentz CS, Jamieson SA, Brewster JL, Chen L, Bogyo M, Mace PD
    Ref: ACS Infect Dis, 6:2771, 2020 : PubMed

            

    Title: Recent human-to-poultry host jump, adaptation, and pandemic spread of Staphylococcus aureus
    Lowder BV, Guinane CM, Ben Zakour NL, Weinert LA, Conway-Morris A, Cartwright RA, Simpson AJ, Rambaut A, Nubel U, Fitzgerald JR
    Ref: Proc Natl Acad Sci U S A, 106:19545, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer