Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: staau-SAV2594

Staphylococcus aureus COCE/NOND family hydrolase, S15 family peptidase

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|Cocaine_esterase
Block| X
Position in NCBI Life Tree|Staphylococcus aureus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Staphylococcaceae: N E > Staphylococcus: N E > Staphylococcus aureus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 3IB3, 3III
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: staau-SAV2594
Colored MSA for Cocaine_esterase (raw)
MNQHLLGNPKLTVTHVNEVKTGINHIVVDSVQYGNQEMIMEKDVTVEMRD
GEKLYINIFRPNKDGKFPVVMSADTYGKDNKPKITNMGALWPTLGAIPTS
SFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVI
EWAAKQPWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYR
EVAFHGGIPDTGFYRFWIQGIFARWTDNPNIEDMIQAQQEHPLFDDFWKQ
RQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEW
ESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSAS
AFPLPNTEYTPLYLNAENHTLNHAKISSAYVAQYDSEDKRQDVSFKYTFD
KDTELVGNMNLKLWVSTTDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENG
QVATGWLRVSHRELDQEKSTIAQPWHKHETELKLSQDEIVPVEIELLPSG
TLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETINNGMHMIYTGGKY
DSQLIIPIVN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNQHLLGNPKLTVTHVNEVKTGINHIVVDSVQYGNQEMIMEKDVTVEMRD
GEKLYINIFRPNKDGKFPVVMSADTYGKDNKPKITNMGALWPTLGAIPTS
SFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVI
EWAAKQPWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYR
EVAFHGGIPDTGFYRFWIQGIFARWTDNPNIEDMIQAQQEHPLFDDFWKQ
RQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEW
ESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSAS
AFPLPNTEYTPLYLNAENHTLNHAKISSAYVAQYDSEDKRQDVSFKYTFD
KDTELVGNMNLKLWVSTTDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENG
QVATGWLRVSHRELDQEKSTIAQPWHKHETELKLSQDEIVPVEIELLPSG
TLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETINNGMHMIYTGGKY
DSQLIIPIVN


References
30 more
    Title: Genome analysis of the meat starter culture bacterium Staphylococcus carnosus TM300
    Rosenstein R, Nerz C, Biswas L, Resch A, Raddatz G, Schuster SC, Gotz F
    Ref: Applied Environmental Microbiology, 75:811, 2009 : PubMed

            

    Title: Genome sequence of Staphylococcus aureus strain Newman and comparative analysis of staphylococcal genomes: polymorphism and evolution of two major pathogenicity islands
    Baba T, Bae T, Schneewind O, Takeuchi F, Hiramatsu K
    Ref: Journal of Bacteriology, 190:300, 2008 : PubMed

            

    Title: Genome sequencing and analysis reveals possible determinants of Staphylococcus aureus nasal carriage
    Sivaraman K, Venkataraman N, Tsai J, Dewell S, Cole AM
    Ref: BMC Genomics, 9:433, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer