Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: staau-d2feb3

Staphylococcus aureus Putative uncharacterized protein Bontoxilysin

Comment
Other strains: Staphylococcus aureus (strains C427; 68-397; M876; M899; E1410; WBG10049; C101; M809; 65-1322; A017934/97; C160; 55/2053; WW2703/97; Btn1260; 58-424; TCH60; M1015; MRSA252; JKD6159; EMRSA16; MN8; D139; H19; ED133); Staphylococcus schleiferi


Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Staphylococcus aureus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Staphylococcaceae: N E > Staphylococcus: N E > Staphylococcus aureus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: staau-d2feb3
Colored MSA for Lipase_3 (raw)
MNLSDALSRSVSDMSYENLDKDQTYDFLGQDYKVIEKRDDTQNGFRAYVF
APVIKGKVDKSQLLIGYAGTDPYSLNDIRTDLQLPIHHNTNNLKINNHYK
DLKNSTIHKKYNTIKDKNDLFSFSSNLNNKALFGDLWAAKFAPTQMDESD
AFTESVKKKYPDSEIHPLGHSLGAFLAQYNLIKHNLDNGTTFAAPNVYHS
FTGDFKKDIDNGVYDSKIRNIGHFDDPINNLNFFNPRIGKNITSMPHYDG
FITNLPLIGQHTLKSYNDFDADGNVKEMPELEQFNDDQSLNNRFQLFDPF
GIKSRFFDSIKIDSSILNRTSENDFDPFAILNKKDKLFESNDLDIEGFNN
KQKEDLSIDLNPFDDELNDEDEPLIPKRGDSKKLKAEKKISVKKTKSSSK
NSGKKVIIQPDEVRNIASTIRDRLFLYTQIITALDEYREETMSGANRILD
KYQSELLSGSHEFITPNDLEQYMEILSVEGSSGNFKFYNSGLMDDLIQAL
DQNKKDLLQFAEKLEFAANKFEEKDLEESDVFGLFS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNLSDALSRSVSDMSYENLDKDQTYDFLGQDYKVIEKRDDTQNGFRAYVF
APVIKGKVDKSQLLIGYAGTDPYSLNDIRTDLQLPIHHNTNNLKINNHYK
DLKNSTIHKKYNTIKDKNDLFSFSSNLNNKALFGDLWAAKFAPTQMDESD
AFTESVKKKYPDSEIHPLGHSLGAFLAQYNLIKHNLDNGTTFAAPNVYHS
FTGDFKKDIDNGVYDSKIRNIGHFDDPINNLNFFNPRIGKNITSMPHYDG
FITNLPLIGQHTLKSYNDFDADGNVKEMPELEQFNDDQSLNNRFQLFDPF
GIKSRFFDSIKIDSSILNRTSENDFDPFAILNKKDKLFESNDLDIEGFNN
KQKEDLSIDLNPFDDELNDEDEPLIPKRGDSKKLKAEKKISVKKTKSSSK
NSGKKVIIQPDEVRNIASTIRDRLFLYTQIITALDEYREETMSGANRILD
KYQSELLSGSHEFITPNDLEQYMEILSVEGSSGNFKFYNSGLMDDLIQAL
DQNKKDLLQFAEKLEFAANKFEEKDLEESDVFGLFS


References
    Title: Complete genome sequence of Staphylococcus aureus strain JKD6159, a unique Australian clone of ST93-IV community methicillin-resistant Staphylococcus aureus
    Chua K, Seemann T, Harrison PF, Davies JK, Coutts SJ, Chen H, Haring V, Moore R, Howden BP, Stinear TP
    Ref: Journal of Bacteriology, 192:5556, 2010 : PubMed

            

    Title: Evolutionary genomics of Staphylococcus aureus reveals insights into the origin and molecular basis of ruminant host adaptation
    Guinane CM, Ben Zakour NL, Tormo-Mas MA, Weinert LA, Lowder BV, Cartwright RA, Smyth DS, Smyth CJ, Lindsay JA and Fitzgerald JR <6 more author(s)>
    Ref: Genome Biol Evol, 2:454, 2010 : PubMed

            

    Title: Complete genomes of two clinical Staphylococcus aureus strains: evidence for the rapid evolution of virulence and drug resistance
    Holden MT, Feil EJ, Lindsay JA, Peacock SJ, Day NP, Enright MC, Foster TJ, Moore CE, Hurst L and Parkhill J <35 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:9786, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer