Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: staau-lipas

Staphylococcus aureus gene for lipase lip2, lipase 2, geh lipase. Glycerol ester hydrolase 2

Comment
Rosenstein R, Gotz F a review on Staphylococcal lipases. There is a long precursor which is cut to a 46kDa active form


Relationship
Family|Bacterial_lip_FamI.6
Block| L
Position in NCBI Life Tree|Staphylococcus aureus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Staphylococcaceae: N E > Staphylococcus: N E > Staphylococcus aureus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 6KSI, 6KSL, 6KSM
No kinetic





No Substrate
1 inhbitor:
Orlistat
>3 Genbank links 61 more: M12715, AP003130, ACHC01000008
>3 UniProt links 8 more: P10335, Q99WQ6, Q2G155
3 Structure : 6KSI, 6KSL, 6KSM
>3 UniProt links 8 more: Q99WQ6, P10335, Q2G155
>3 Interpro links 8 more: Q99WQ6, P10335, Q2G155
>3 Prodom links 8 more: Q99WQ6, P10335, Q2G155
>3 Pfam links 8 more: Q99WQ6, P10335, Q2G155
>3 PIRSF links 8 more: Q99WQ6, P10335, Q2G155
>3 SUPERFAM links 8 more: Q99WQ6, P10335, Q2G155
Sequence
Graphical view for this peptide sequence: staau-lipas
Colored MSA for Bacterial_lip_FamI.6 (raw)
GQNSPEKPTDKNTDNKQLIKDALQAPKTRSTTNAAADAKKVRPLKANQVQ
PLNKYPVVFVHGFLGLVGDNAPALYPNYWGGNKFKVIEELRKQGYNVHQA
SVSAFGSNYDRAVELYYYIKGGRVDYGAAHAAKYGHERYGKTYKGIMPNW
EPGKKVHLVGHSMGGQTIRLMEEFLRNGNKEEIAYHKAHGGEISPLFTGG
HNNMVASITTLATPHNGSQAADKFGNTEAVRKIMFALNRFMGNKYSNIDL
GLTQWGFKQLPNESYIDYIKRVSKSKIWTSDDNAAYDLTLDGSAKLNNMT
SMNPNITYTTYTGVSSHTGPLGYENPDLGTFFLMATTSRIIGHDAREEWR
KNDGVVPVISSLHPSNQPFVNVTNDEPATRRGIWQVKPIIQGWDHVDFIG
VDFLDFKRKGAELANFYTGIINDLLRVEATESKGTQLKAS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GQNSPEKPTDKNTDNKQLIKDALQAPKTRSTTNAAADAKKVRPLKANQVQ
PLNKYPVVFVHGFLGLVGDNAPALYPNYWGGNKFKVIEELRKQGYNVHQA
SVSAFGSNYDRAVELYYYIKGGRVDYGAAHAAKYGHERYGKTYKGIMPNW
EPGKKVHLVGHSMGGQTIRLMEEFLRNGNKEEIAYHKAHGGEISPLFTGG
HNNMVASITTLATPHNGSQAADKFGNTEAVRKIMFALNRFMGNKYSNIDL
GLTQWGFKQLPNESYIDYIKRVSKSKIWTSDDNAAYDLTLDGSAKLNNMT
SMNPNITYTTYTGVSSHTGPLGYENPDLGTFFLMATTSRIIGHDAREEWR
KNDGVVPVISSLHPSNQPFVNVTNDEPATRRGIWQVKPIIQGWDHVDFIG
VDFLDFKRKGAELANFYTGIINDLLRVEATESKGTQLKAS


References
18 more
    Title: Crystal structure of pathogenic Staphylococcus aureus lipase complex with the anti-obesity drug orlistat
    Kitadokoro K, Tanaka M, Hikima T, Okuno Y, Yamamoto M, Kamitani S
    Ref: Sci Rep, 10:5469, 2020 : PubMed

            

    Title: Bacterial lipolysis of immune-activating ligands promotes evasion of innate defenses
    Chen X, Alonzo F, 3rd
    Ref: Proc Natl Acad Sci U S A, 116:3764, 2019 : PubMed

            

    Title: Staphylococcus aureus lipase: purification, kinetic characterization, crystallization and crystallographic study
    Tanaka M, Kamitani S, Kitadokoro K
    Ref: Acta Crystallographica F Struct Biol Commun, 74:567, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer