Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: staep-GEHD

Staphylococcus epidermidis EH46 lipase precursor (EC 3.1.1.3) GehD SEL-2 serp2388

Comment
EH46 promiscuous activity 23/96 substrates Martinez-Martinez et al. 2018 Rosenstein R, Gotz F a review on Staphylococcal lipases. There is a long precursor which is cut to a 46kDa active form


Relationship
Family|Bacterial_lip_FamI.6
Block| L
Position in NCBI Life Tree|Staphylococcus epidermidis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Staphylococcaceae: N E > Staphylococcus: N E > Staphylococcus epidermidis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : WP_029376389, AF090142, AE016744
1 UniProt : Q5HKF8
2 UniProt : Q9Z4M7, Q5HKF8
2 Interpro : Q9Z4M7, Q5HKF8
2 Prodom : Q9Z4M7, Q5HKF8
2 Pfam : Q9Z4M7, Q5HKF8
2 PIRSF : Q9Z4M7, Q5HKF8
2 SUPERFAM : Q9Z4M7, Q5HKF8
Sequence
Graphical view for this peptide sequence: staep-GEHD
Colored MSA for Bacterial_lip_FamI.6 (raw)
VHKIGNTKTDKTVKTNQKKQTSLTSPRVVKSKQTKHINQLTAQAQYKNQY
PVVFVHGFVGLVGEDAFSMYPNYWGGIKYNVKKELTKLGYRVHEANVGAF
SSNYDRAVELYYYIKGGRVDYGAAHAAKYGHKRYGRTYEGIMPDWEPGKK
IHLVGHSMGGQTIRLMEHFLRNGNQEEIDYQRQYGGTVSDLFKGGQDNMV
STITTLGTPHNGTPAADKLGSTKFIKDTINRIGKIGGTKALDLELGFSQW
GFKQQPNESYAEYAKRIANSKVWETEDQAVNDLTTAGAEKLNQMTTLNPN
IVYTSYTGAATHTGPLGNEVPNIRQFPLFDLTSRVIGGDDNKNVRVNDGI
VPVSSSLHPSDEAFKKVGMMNLATDKGIWQVRPVQYDWDHLDLVGLDTTD
YKRTGEELGQFYMSMINNMLKVEELDGITRK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

VHKIGNTKTDKTVKTNQKKQTSLTSPRVVKSKQTKHINQLTAQAQYKNQY
PVVFVHGFVGLVGEDAFSMYPNYWGGIKYNVKKELTKLGYRVHEANVGAF
SSNYDRAVELYYYIKGGRVDYGAAHAAKYGHKRYGRTYEGIMPDWEPGKK
IHLVGHSMGGQTIRLMEHFLRNGNQEEIDYQRQYGGTVSDLFKGGQDNMV
STITTLGTPHNGTPAADKLGSTKFIKDTINRIGKIGGTKALDLELGFSQW
GFKQQPNESYAEYAKRIANSKVWETEDQAVNDLTTAGAEKLNQMTTLNPN
IVYTSYTGAATHTGPLGNEVPNIRQFPLFDLTSRVIGGDDNKNVRVNDGI
VPVSSSLHPSDEAFKKVGMMNLATDKGIWQVRPVQYDWDHLDLVGLDTTD
YKRTGEELGQFYMSMINNMLKVEELDGITRK


References
2 more
    Title: Characterization of Serine Hydrolases Across Clinical Isolates of Commensal Skin Bacteria Staphylococcus epidermidis Using Activity-Based Protein Profiling
    Keller LJ, Lentz CS, Chen YE, Metivier RJ, Weerapana E, Fischbach MA, Bogyo M
    Ref: ACS Infect Dis, 6:930, 2020 : PubMed

            

    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            

    Title: Genome-based analysis of virulence genes in a non-biofilm-forming Staphylococcus epidermidis strain (ATCC 12228)
    Zhang YQ, Ren SX, Li HL, Wang YX, Fu G, Yang J, Qin ZQ, Miao YG, Wang WY and Wen YM <7 more author(s)>
    Ref: Molecular Microbiology, 49:1577, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer