Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: stalu-q0kkp0

Staphylococcus lugdunensis, Streptococcus gallolyticus, Tannase TanA

Comment
Other strains: Staphylococcus lugdunensis (strains HKU09-01; ACS-027-V-Sch2; VCU139; N920143; M23590) Streptococcus gallolyticus (Streptococcus bovis biotype I)


Relationship
Family|Tannase_Bact
Block| H
Position in NCBI Life Tree|Staphylococcus lugdunensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Staphylococcaceae: N E > Staphylococcus: N E > Staphylococcus lugdunensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 5 more: AB244239, AB375861, CP001837
2 UniProt : Q0KKP0, B9A0V9
2 UniProt : Q0KKP0, B9A0V9
2 Interpro : Q0KKP0, B9A0V9
2 Prodom : Q0KKP0, B9A0V9
2 Pfam : Q0KKP0, B9A0V9
2 PIRSF : Q0KKP0, B9A0V9
2 SUPERFAM : Q0KKP0, B9A0V9
Sequence
Graphical view for this peptide sequence: stalu-q0kkp0
Colored MSA for Tannase_Bact (raw)
MKKTFISLLSATVILSGCGVGEHQNNNSNHDAKGVNTSNVKIKNYNQASS
ALQIDNSKWKYDSKNNVYYQLNISYVSNPQAKNVEKLGIYVPAAYFKGKK
NHNGTYTVTVNDAKKVNGYSARTAPIVYPVNTPGYAEQSAPTSYRYSNIS
KYMKAGFIYVEAGLRGRSMSMGNNSSNASTKSYETGSPWGVTDLKAAIRY
YRFNDSSLPGNSSKIYTFGHSGGGAQSAIAGASGDSKLYYKYLEQIGAAM
TDKNGKYISDKIDGAMAWCPITSLDQADAAYEWQMGQYGNEGNRKKNSFQ
KQLSTDLASSYASYLNKLNLKNGNTTLSLTKSKNGQYTEGSYAKYLKKEI
EDSATEFLNNTTFPYKQNSTEQAGMGNGGPSGGKPSGKMGSMPQMRKQSS
NKTYKTMDAYLKDLNKKGTWITYDKKTKRAHITSLKDFAKYYKQPSKSVS
AFDDLKRSQAENEVFGTSGSDSKLHFDQSLAKLLTENKSNYSKLNGWNSN
YVSSYKNDLTKTDKLGTSMSTRMNMYNPMYYLSDYYSGYGKSNVANHWRI
RTGIQQGDTALNTETNLSLALKERVGSKNVDFKTVWDQGHTMAETSGNSD
SNFIKWVESINKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKTFISLLSATVILSGCGVGEHQNNNSNHDAKGVNTSNVKIKNYNQASS
ALQIDNSKWKYDSKNNVYYQLNISYVSNPQAKNVEKLGIYVPAAYFKGKK
NHNGTYTVTVNDAKKVNGYSARTAPIVYPVNTPGYAEQSAPTSYRYSNIS
KYMKAGFIYVEAGLRGRSMSMGNNSSNASTKSYETGSPWGVTDLKAAIRY
YRFNDSSLPGNSSKIYTFGHSGGGAQSAIAGASGDSKLYYKYLEQIGAAM
TDKNGKYISDKIDGAMAWCPITSLDQADAAYEWQMGQYGNEGNRKKNSFQ
KQLSTDLASSYASYLNKLNLKNGNTTLSLTKSKNGQYTEGSYAKYLKKEI
EDSATEFLNNTTFPYKQNSTEQAGMGNGGPSGGKPSGKMGSMPQMRKQSS
NKTYKTMDAYLKDLNKKGTWITYDKKTKRAHITSLKDFAKYYKQPSKSVS
AFDDLKRSQAENEVFGTSGSDSKLHFDQSLAKLLTENKSNYSKLNGWNSN
YVSSYKNDLTKTDKLGTSMSTRMNMYNPMYYLSDYYSGYGKSNVANHWRI
RTGIQQGDTALNTETNLSLALKERVGSKNVDFKTVWDQGHTMAETSGNSD
SNFIKWVESINKK


References
    Title: Genome sequence of Staphylococcus lugdunensis N920143 allows identification of putative colonization and virulence factors
    Heilbronner S, Holden MT, Van Tonder A, Geoghegan JA, Foster TJ, Parkhill J, Bentley SD
    Ref: FEMS Microbiology Letters, 322:60, 2011 : PubMed

            

    Title: Complete genome sequence of Staphylococcus lugdunensis strain HKU09-01
    Tse H, Tsoi HW, Leung SP, Lau SK, Woo PC, Yuen KY
    Ref: Journal of Bacteriology, 192:1471, 2010 : PubMed

            

    Title: Association of tannase-producing Staphylococcus lugdunensis with colon cancer and characterization of a novel tannase gene
    Noguchi N, Ohashi T, Shiratori T, Narui K, Hagiwara T, Ko M, Watanabe K, Miyahara T, Taira S and Sasatsu M <1 more author(s)>
    Ref: J Gastroenterol, 42:346, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer