Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: stema-a0a218l045

Stenotrophomonas maltophilia (Pseudomonas maltophilia) (Xanthomonas maltophilia) lipSm Secreted lipase

Comment
Called prototype of a proposed new bacterial lipase family (XVIII). However not really separate from Fungal-Bact_LIP Family_XVII


Relationship
Family|Fungal-Bact_LIP
Block| X
Position in NCBI Life Tree|Stenotrophomonas maltophilia
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Stenotrophomonas: N E > Stenotrophomonas maltophilia group: N E > Stenotrophomonas maltophilia: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ARJ54612
1 UniProt : A0A218L045
1 UniProt : A0A218L045
1 Interpro : A0A218L045
1 Pfam : A0A218L045
1 PIRSF : A0A218L045
1 SUPERFAM : A0A218L045
Sequence
Graphical view for this peptide sequence: stema-a0a218l045
Colored MSA for Fungal-Bact_LIP (raw)
MTPPPRRIRPLTCLLAATLLALSSGPLAAAPVAPGDLLSAAPYRASWVPS
KAAQAYKLHYRTPDHRGQLAEGTGLLYLPAGAAPAGGWPVVSWAHGTQGI
ADRCAPSVSGPYQPERDGRFLDQFLAQGYAVVAADYQGLGNPGDHAYLHV
RTAARNAIDLIKASRQYLGTATLSPRWVSVGHSQGGAAALTAGHIAPTYG
GPALHYRGSFTTGTPTAVELTALVMKPDNRTANPGALNAYHAYLLDGLLQ
VAPQIDRVLSDTGRARVAVAREQCLGELAATLDGADTGSMFTAPLTSVPG
IWAVLYDYLGVPRRGFSQPLMLGHGSADRDVPYLTTLLYAAGLALRGEPV
AFRRYPVDHRGTLDAAAADGLAFVRARLGDAHFNEAAETAHLEQVLDESP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTPPPRRIRPLTCLLAATLLALSSGPLAAAPVAPGDLLSAAPYRASWVPS
KAAQAYKLHYRTPDHRGQLAEGTGLLYLPAGAAPAGGWPVVSWAHGTQGI
ADRCAPSVSGPYQPERDGRFLDQFLAQGYAVVAADYQGLGNPGDHAYLHV
RTAARNAIDLIKASRQYLGTATLSPRWVSVGHSQGGAAALTAGHIAPTYG
GPALHYRGSFTTGTPTAVELTALVMKPDNRTANPGALNAYHAYLLDGLLQ
VAPQIDRVLSDTGRARVAVAREQCLGELAATLDGADTGSMFTAPLTSVPG
IWAVLYDYLGVPRRGFSQPLMLGHGSADRDVPYLTTLLYAAGLALRGEPV
AFRRYPVDHRGTLDAAAADGLAFVRARLGDAHFNEAAETAHLEQVLDESP


Reference
    Title: Molecular, biochemical and kinetic analysis of a novel, thermostable lipase (LipSm) from Stenotrophomonas maltophilia Psi-1, the first member of a new bacterial lipase family (XIX)
    Parapouli M, Foukis A, Stergiou PY, Koukouritaki M, Magklaras P, Gkini OA, Papamichael EM, Afendra AS, Hatziloukas E
    Ref: J Biol Res (Thessalon), 25:4, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer