Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: stija-a0a2g8jll0

Apostichopus Stichopus japonicus (Sea cucumber) Carboxylic ester hydrolase

Relationship
Family|Cholinesterase-like
Block| C
Position in NCBI Life Tree|Apostichopus japonicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Echinodermata: N E > Eleutherozoa: N E > Echinozoa: N E > Holothuroidea: N E > Aspidochirotacea: N E > Aspidochirotida: N E > Stichopodidae: N E > Apostichopus: N E > Apostichopus japonicus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 UniProt : A0A2G8JLL0
1 Interpro : A0A2G8JLL0
1 Prodom : A0A2G8JLL0
1 Pfam : A0A2G8JLL0
1 PIRSF : A0A2G8JLL0
1 SUPERFAM : A0A2G8JLL0
Sequence
Graphical view for this peptide sequence: stija-a0a2g8jll0
Colored MSA for Cholinesterase-like (raw)
MSIFLLLLLTSSEVFSQLGSDLIIDSTIGKIRGVDQDYAYGFLGIPFAQP
PVGDLRLREPQPVIPWEDIFEANEKSPGVCRSVTNHQTAAHSRYKHISVY
SKVDEDCLYLNLWVPKTGRTDYPTMIFMHGGRFRDGSGSALLYDGRILAQ
DADAIIITINYRTEAFGWLFLGDVHDPATGKKESIANHGLRDQKMAFKWT
KDNIALVGGDPNKITISGQSAGAQSVGVHLVSEESRDLFDQALMFSNPYS
LPFKLLDDGVALGKGVANLIGCPDVFDLDCWRAVSAEDLLAASRQATSAI
YNPNEILQIFEPWSPAVGPYTELPEEVMIVNQQGAAQKKPTMLGTVREEG
WPYITGIFRNELGNLQYRLFLKAIIPPYYRELINLYPADNTRDADQRNIL
SDTCTDFIFYCPSINISLSMSDQGYDNFYFYVLNSAWSFEEEWTEKYKDC
WGHVCHGGDLPYIFRSGPLATYLTPPVKRK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSIFLLLLLTSSEVFSQLGSDLIIDSTIGKIRGVDQDYAYGFLGIPFAQP
PVGDLRLREPQPVIPWEDIFEANEKSPGVCRSVTNHQTAAHSRYKHISVY
SKVDEDCLYLNLWVPKTGRTDYPTMIFMHGGRFRDGSGSALLYDGRILAQ
DADAIIITINYRTEAFGWLFLGDVHDPATGKKESIANHGLRDQKMAFKWT
KDNIALVGGDPNKITISGQSAGAQSVGVHLVSEESRDLFDQALMFSNPYS
LPFKLLDDGVALGKGVANLIGCPDVFDLDCWRAVSAEDLLAASRQATSAI
YNPNEILQIFEPWSPAVGPYTELPEEVMIVNQQGAAQKKPTMLGTVREEG
WPYITGIFRNELGNLQYRLFLKAIIPPYYRELINLYPADNTRDADQRNIL
SDTCTDFIFYCPSINISLSMSDQGYDNFYFYVLNSAWSFEEEWTEKYKDC
WGHVCHGGDLPYIFRSGPLATYLTPPVKRK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer