Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: stoca-ACHE

Stomoxys calcitrans (Stable fly) (Conops calcitrans) acetylcholinesterase 2 mRNA, partial cds

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Stomoxys calcitrans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Calyptratae: N E > Muscoidea: N E > Muscidae: N E > Muscinae: N E > Stomoxyini: N E > Stomoxys: N E > Stomoxys calcitrans: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: NP_001298178, GQ244479, HM125963
2 UniProt : C7E3N3, F8QV18
1 Ncbi-nid : 253723336
1 Ncbi-pid : 253723337
3 UniProt : C7E3N3, F8QV18, A0A1I8QF11
3 Interpro : C7E3N3, F8QV18, A0A1I8QF11
3 Prodom : C7E3N3, F8QV18, A0A1I8QF11
3 Pfam : C7E3N3, F8QV18, A0A1I8QF11
3 PIRSF : C7E3N3, F8QV18, A0A1I8QF11
3 SUPERFAM : C7E3N3, F8QV18, A0A1I8QF11
Sequence
Graphical view for this peptide sequence: stoca-ACHE
Colored MSA for ACHE (raw)
MARSIKASLSSSSSSQSQSPLSSSSSRLSQSSSSLYSLKKSTSSSSLTSS
LSRPSSFGLVSYLLATRNNDICRGLLATLVILLRMTALASAMTDHLIVQT
TSGPVRGRSVTVQGREVHVFTGIPYAKPPVDDLRFRKPVPAEPWHGVLDA
TRLPATCVQERYEYFPGFSGEEMWNPNTNVSEDCLFMNIWAPAKARLRHG
RGTNGGEHSAKTDQDHLIHSATPQNTTNGLPILIWIYGGGFMTGSATLDI
YNAEIMSAVGNVIVASFQYRVGAFGFLHLSPVMPGFEEEAPGNVGLWDQA
LALRWLKENARAFGGNPEWMTLFGESAGSSSVNAQLMSPITRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASLLPDNPQAVMACMRSVD
AKTISVQQWNSYSGILSLPSAPTIDGAFLPADPMTLLKTADLSGYDILIG
NVKDEGTYFLLYDFIDYFDKDDATSLPRDKYLEIMNNIFNKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQSLAERGAGVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNTSLQYRPVERELGKRMLNA
VIEFAKTGNPAVDGEEWPNFSKEDPVYYVFSTDEKTEKLQRGPLAKRCSF
WNDYLPKVRSWAGSECEGNISLSASGTIYQTQQQHSVLLNVALVLTLVFS
IFQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARSIKASLSSSSSSQSQSPLSSSSSRLSQSSSSLYSLKKSTSSSSLTSS
LSRPSSFGLVSYLLATRNNDICRGLLATLVILLRMTALASAMTDHLIVQT
TSGPVRGRSVTVQGREVHVFTGIPYAKPPVDDLRFRKPVPAEPWHGVLDA
TRLPATCVQERYEYFPGFSGEEMWNPNTNVSEDCLFMNIWAPAKARLRHG
RGTNGGEHSAKTDQDHLIHSATPQNTTNGLPILIWIYGGGFMTGSATLDI
YNAEIMSAVGNVIVASFQYRVGAFGFLHLSPVMPGFEEEAPGNVGLWDQA
LALRWLKENARAFGGNPEWMTLFGESAGSSSVNAQLMSPITRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASLLPDNPQAVMACMRSVD
AKTISVQQWNSYSGILSLPSAPTIDGAFLPADPMTLLKTADLSGYDILIG
NVKDEGTYFLLYDFIDYFDKDDATSLPRDKYLEIMNNIFNKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQSLAERGAGVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNTSLQYRPVERELGKRMLNA
VIEFAKTGNPAVDGEEWPNFSKEDPVYYVFSTDEKTEKLQRGPLAKRCSF
WNDYLPKVRSWAGSECEGNISLSASGTIYQTQQQHSVLLNVALVLTLVFS
IFQ


Reference
    Title: Acetylcholinesterase of Stomoxys calcitrans (L.) (Diptera: Muscidae): cDNA sequence, baculovirus expression, and biochemical properties
    Temeyer KB, Chen AC
    Ref: Vet Parasitol, 184:92, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer