Gene_locus Report for: stra9-a0a059w144Streptomyces albulus. Uncharacterized protein Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces albulus: N E
CarbLipBact_2 : stra9-a0a059w0h4Streptomyces albulus. Carboxylesterase. Carboxymethylbutenolide_lactonase : stra9-a0a059wbj0Streptomyces albulus. 3-oxoadipate enol-lactone hydrolase. Carb_B_Bacteria : stra9-s9xss1Streptomyces albulus, Uncharacterized protein, stra9-s9xsz3Streptomyces albulus Uncharacterized protein. Chlorophyllase : stra9-a0a059wak3Streptomyces albulus. Uncharacterized protein. Duf_1023 : stra9-a0a059vzq9Streptomyces albulus. Uncharacterized protein, stra9-a0a059w6h4Streptomyces albulus. Secreted protein, stra9-a0a059w747Streptomyces albulus. Uncharacterized protein, stra9-a0a059w9a5Streptomyces albulus. Uncharacterized protein, stra9-a0a059w9h0Streptomyces albulus. Uncharacterized protein, stra9-a0a059wia7Streptomyces albulus. Uncharacterized protein, stra9-a0a1a9qhg8Streptomyces albulus, Uncharacterized protein, stra9-a0a1a9qiy3Streptomyces albulus, Uncharacterized protein, stra9-a0a1a9qm80Streptomyces albulus, Uncharacterized protein, stra9-a0a1a9qmw8Streptomyces albulus, Uncharacterized protein. Lactobacillus_peptidase : 9acto-q2wfe0Streptomyces albulus putative x-pro dipeptidyl-peptidase. NFM-deformylase : stra9-a0a059vx34Streptomyces albulus. Alpha/beta hydrolase fold. Peptidase_S37 : stra9-a0a059w351Streptomyces albulus. Uncharacterized protein Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Streptomyces albulus CCRC 11814: N, E.
Streptomyces albulus PD-1: N, E.
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: stra9-a0a059w144 Colored MSA for Duf_1023 (raw)
RYAALLAPGRRILAFDPRGRGQVAEVHGDLASAQHVAVIVPGSDIDLSTF
DRTTDRYGTPTGMAASLRRQMAVEAPQVRTAVIAWVGYTTPVGLGPDAAT
GRLAEAGAPRLNRFLAGLAATGAPAPAVLCHSYGSVVCGLAVPHAGRGRL
ADLVVFGSPGMRRDDAAQLRTTARVWAARDASDWIGEVPHVELLGLGHGA
DPTDPAFGARRVPAERAQGHTGYLAPGTDSLRNFAAIALGRYGDVH
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
RYAALLAPGRRILAFDPRGRGQVAEVHGDLASAQHVAVIVPGSDIDLSTF DRTTDRYGTPTGMAASLRRQMAVEAPQVRTAVIAWVGYTTPVGLGPDAAT GRLAEAGAPRLNRFLAGLAATGAPAPAVLCHSYGSVVCGLAVPHAGRGRL ADLVVFGSPGMRRDDAAQLRTTARVWAARDASDWIGEVPHVELLGLGHGA DPTDPAFGARRVPAERAQGHTGYLAPGTDSLRNFAAIALGRYGDVH
|
|
|