(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Actinobacteria [phylum]: NE > Actinobacteria [class]: NE > Streptomycetales: NE > Streptomycetaceae: NE > Streptomyces: NE > Streptomyces albulus: NE > Streptomyces albulus CCRC 11814: NE
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MSTRANESETVATPAGDARISWYRDAEPARAVIAVSHGAGGGIEARDLRA LAAALPARGYTVALVEQPWRVAGKKVAPAPKTLDIGWTALWPALEKPGLP VVAGGRSAGARVACRTARALGAHAVLALSFPLHPPGKPERSRGEELTGAG VPTLVVQGGRDPFGRPAEFPAGTALTEVAHGDHGFAVPKSAGVSEAESMA VLTDAVVAWLDGMFG
Reference
Title: Draft Genome Sequence of Streptomyces albulus Strain CCRC 11814, an {varepsilon}-Poly-L-Lysine-Producing Actinomycete Dodd A, Swanevelder D, Featherston J, Rumbold K Ref: Genome Announc, 1:, 2013 : PubMed
Here, we report the draft genome sequence of Streptomyces albulus strain CCRC 11814, a soil-dwelling, Gram-positive bacterium. S. albulus produces epsilon-poly-l-lysine, which has diverse antimicrobial activity. The genome is 9.43 Mb in size, with a G+C content of 72.2%, and contains 9,177 protein-coding sequences.