Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: stra9-s9xss1

Streptomyces albulus, Uncharacterized protein

Comment
Other strains: Streptomyces albulus (CCRC 11814; PD-1)


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Streptomyces albulus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces albulus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AROY02000082, CP007574, AXDB02000039
1 UniProt : A0A059W056
1 UniProt : A0A059W056
1 Interpro : A0A059W056
1 Pfam : A0A059W056
1 PIRSF : A0A059W056
1 SUPERFAM : A0A059W056
Sequence
Graphical view for this peptide sequence: stra9-s9xss1
Colored MSA for Carb_B_Bacteria (raw)
MSERPRARTAEGLVEGCWRGGHAVFRGIPYAQPPVGPLRFQAPAPVEGWS
GTRRATEFGPVVPQAGPTAESSVGNDWLTLNVSTPALGVAGLPVLVWIHG
GAYIAGASSDPMYDPAALTGAGLVVVSINYRVAVEGFALIDGAPANRGLL
DQIAALQWVQRNIAAFGGDPDQVTVAGQSAGAGSIAALLTRERVRGSFRR
AIVHSVPGTLCTRALAEEVTAALAGRVGAAPDAEALSGIAPARLAGELTA
LGADLPGRRTKWGRLAQTGVPVCPVLDGAVLTETPWSALAGGRAGGIELL
VGHTRDEFRLFSVMMGRLGTFTEDEVRTALDLFAPAPGGADAYRAAYPRA
TPEELLELVHSDALFRMPSLRLAQANHAAGGTSFLFALHLSAPASGGVLG
ACHSLDVPLAFGTLDSPVGRHLFGDRPTPEVVAVSRELRQGWVRFATTGD
PGWPAHRPGRRLTRVLDVESKTSPYPAEASRRIWERHDPAPFDLA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSERPRARTAEGLVEGCWRGGHAVFRGIPYAQPPVGPLRFQAPAPVEGWS
GTRRATEFGPVVPQAGPTAESSVGNDWLTLNVSTPALGVAGLPVLVWIHG
GAYIAGASSDPMYDPAALTGAGLVVVSINYRVAVEGFALIDGAPANRGLL
DQIAALQWVQRNIAAFGGDPDQVTVAGQSAGAGSIAALLTRERVRGSFRR
AIVHSVPGTLCTRALAEEVTAALAGRVGAAPDAEALSGIAPARLAGELTA
LGADLPGRRTKWGRLAQTGVPVCPVLDGAVLTETPWSALAGGRAGGIELL
VGHTRDEFRLFSVMMGRLGTFTEDEVRTALDLFAPAPGGADAYRAAYPRA
TPEELLELVHSDALFRMPSLRLAQANHAAGGTSFLFALHLSAPASGGVLG
ACHSLDVPLAFGTLDSPVGRHLFGDRPTPEVVAVSRELRQGWVRFATTGD
PGWPAHRPGRRLTRVLDVESKTSPYPAEASRRIWERHDPAPFDLA


Reference
    Title: Draft Genome Sequence of Streptomyces albulus Strain CCRC 11814, an {varepsilon}-Poly-L-Lysine-Producing Actinomycete
    Dodd A, Swanevelder D, Featherston J, Rumbold K
    Ref: Genome Announc, 1:, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer