Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strag-ESTA

Streptococcus agalactiae (serotype V; serotype III; serotype Ia; H36B; COH1; 515; 18RS21; CJB111) tributyrin esterase

Comment
Q8E4Y4 is for serotype III Q8DZC4 for serotype V


Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Streptococcus agalactiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Streptococcus: N E > Streptococcus agalactiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 5 more: AE014246, AL766849, AAJP01000001
2 UniProt : Q8DZC4, Q8E4Y4
2 Interpro : Q8DZC4, Q8E4Y4
2 Prodom : Q8DZC4, Q8E4Y4
2 Pfam : Q8DZC4, Q8E4Y4
2 PIRSF : Q8DZC4, Q8E4Y4
2 SUPERFAM : Q8DZC4, Q8E4Y4
Sequence
Graphical view for this peptide sequence: strag-ESTA
Colored MSA for A85-EsteraseD-FGH (raw)
MAFFNIEYHSKVLGTERQVNVIYPDAFEMSDDKIDDCDIPVLYLLHGMGG
NENSWQKRTNIERLLRHTNLIVVMPSTDLAWYTNTKYGLDYFDAIAIELP
KVLKRFFPNMSDKREKNFIAGLSMGGYGAYKIALLTNRFSHAASLSGALS
FDFDLLFNNGNNNINYWSGIFGDLNNTDNIERHSLRRYVESFDMKTKFYA
WCGYEDFLFEANEVAIDELRQLGLTIDYFNDHGKHEWYYWNQQLEKVLEW
LPVDYVKEERLS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAFFNIEYHSKVLGTERQVNVIYPDAFEMSDDKIDDCDIPVLYLLHGMGG
NENSWQKRTNIERLLRHTNLIVVMPSTDLAWYTNTKYGLDYFDAIAIELP
KVLKRFFPNMSDKREKNFIAGLSMGGYGAYKIALLTNRFSHAASLSGALS
FDFDLLFNNGNNNINYWSGIFGDLNNTDNIERHSLRRYVESFDMKTKFYA
WCGYEDFLFEANEVAIDELRQLGLTIDYFNDHGKHEWYYWNQQLEKVLEW
LPVDYVKEERLS


References
    Title: Genome analysis of multiple pathogenic isolates of Streptococcus agalactiae: implications for the microbial pan-genome
    Tettelin H, Masignani V, Cieslewicz MJ, Donati C, Medini D, Ward NL, Angiuoli SV, Crabtree J, Jones AL and Fraser CM <36 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 102:13950, 2005 : PubMed

            

    Title: Genome sequence of Streptococcus agalactiae, a pathogen causing invasive neonatal disease
    Glaser P, Rusniok C, Buchrieser C, Chevalier F, Frangeul L, Msadek T, Zouine M, Couve E, Lalioui L and Kunst F <2 more author(s)>
    Ref: Molecular Microbiology, 45:1499, 2002 : PubMed

            

    Title: Complete genome sequence and comparative genomic analysis of an emerging human pathogen, serotype V Streptococcus agalactiae
    Tettelin H, Masignani V, Cieslewicz MJ, Eisen JA, Peterson S, Wessels MR, Paulsen IT, Nelson KE, Margarit I and Fraser CM <33 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:12391, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer