Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strag-a0a0h1ywg1

Streptococcus agalactiae. Accessory Sec system protein Asp2

Comment
Other strains: Streptococcus agalactiae (serogroup III; FSL C1-494; FSL S3-170; MRI Z1-213; MRI Z1-214; MRI Z1-216; FSL C1-487; MRI Z1-217)


Relationship
Family|Asp2
Block| X
Position in NCBI Life Tree|Streptococcus agalactiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Streptococcus: N E > Streptococcus agalactiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: LBKJ01000082, LBLH01000053, WP_000413125
1 UniProt : A0A0H1YWG1
2 UniProt : A0A0H1YWG1, Q3S2Y5
2 Interpro : A0A0H1YWG1, Q3S2Y5
2 Prodom : A0A0H1YWG1, Q3S2Y5
2 Pfam : A0A0H1YWG1, Q3S2Y5
2 PIRSF : A0A0H1YWG1, Q3S2Y5
2 SUPERFAM : A0A0H1YWG1, Q3S2Y5
Sequence
Graphical view for this peptide sequence: strag-a0a0h1ywg1
Colored MSA for Asp2 (raw)
MEKLKILQIGEEPWDADLITPDNIEWLYCNGNAIQIFLEKLKSKELEKNN
VEYIGKTSTNEVKLWFNAVILTSEVSELQLNLLSDCLEAHTLFYDEDFQL
DFCSENGIFKRKVLRPLPFNGSRKEKIIFLSRTLFSEQYGAKLKVSDIDL
NPDFKGEIIYEGNSSICFSGDFGEDFQPLFSFRYNLSSTDKAIEIWQEYQ
KLQGDNSIMIEVIQYQKGSLDLILNTKYLSENDLADPYILEYDESVGFSS
ISIFARGDGVVRFGALHWRYSRKGLGQFLIGGERYSDSKRQEFIYYFNPG
DMKPPLNVYFSGFRGAEGFEGFYMMKRLGAPFLLIGDPRIEGGSFYLGTS
EYESELENVLQKYLDYLQFDHCQLILSGLSMGSFGALYYGSTFSPHAIVV
GKPFTNLGDMVVNLKLRRPDDFETSMDILQNIIGSQNDEAINQFNQKFWN
KFKRSNFEKTQFAISYMKHDDYDRDATPRLIDYFSKTNTLLYASGYAGRH
NDNSQSINNWFTSQYKTILSDDFGRVFSD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEKLKILQIGEEPWDADLITPDNIEWLYCNGNAIQIFLEKLKSKELEKNN
VEYIGKTSTNEVKLWFNAVILTSEVSELQLNLLSDCLEAHTLFYDEDFQL
DFCSENGIFKRKVLRPLPFNGSRKEKIIFLSRTLFSEQYGAKLKVSDIDL
NPDFKGEIIYEGNSSICFSGDFGEDFQPLFSFRYNLSSTDKAIEIWQEYQ
KLQGDNSIMIEVIQYQKGSLDLILNTKYLSENDLADPYILEYDESVGFSS
ISIFARGDGVVRFGALHWRYSRKGLGQFLIGGERYSDSKRQEFIYYFNPG
DMKPPLNVYFSGFRGAEGFEGFYMMKRLGAPFLLIGDPRIEGGSFYLGTS
EYESELENVLQKYLDYLQFDHCQLILSGLSMGSFGALYYGSTFSPHAIVV
GKPFTNLGDMVVNLKLRRPDDFETSMDILQNIIGSQNDEAINQFNQKFWN
KFKRSNFEKTQFAISYMKHDDYDRDATPRLIDYFSKTNTLLYASGYAGRH
NDNSQSINNWFTSQYKTILSDDFGRVFSD


Reference
    Title: Genomic analysis reveals the molecular basis for capsule loss in the group B Streptococcus population
    Rosini R, Campisi E, De Chiara M, Tettelin H, Rinaudo D, Toniolo C, Metruccio M, Guidotti S, Sorensen UB and Margarit I <5 more author(s)>
    Ref: PLoS ONE, 10:e0125985, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer