Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: stram-q1rqu8

Streptomyces ambofaciens Alp1U from the biosynthesis of kinamycins

Comment
Other strains: ATCC 23877


Relationship
Family|CFTR-inhibitory-factor_Cif
Block| X
Position in NCBI Life Tree|Streptomyces ambofaciens ATCC 23877
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces ambofaciens: N E > Streptomyces ambofaciens ATCC 23877: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 6KXH, 6KXR, 7CLZ
No kinetic





1 substrate:
Fluostatin-C
No inhibitor
>3 Genbank links 6 more: AJ937741, AM238664, AJ937740
2 UniProt : Q1RQU8, Q0JWC8
3 Structure : 7CLZ, 6KXR, 6KXH
2 UniProt : Q1RQU8, Q0JWC8
2 Interpro : Q1RQU8, Q0JWC8
2 Prodom : Q1RQU8, Q0JWC8
2 Pfam : Q1RQU8, Q0JWC8
2 PIRSF : Q1RQU8, Q0JWC8
2 SUPERFAM : Q1RQU8, Q0JWC8
Sequence
Graphical view for this peptide sequence: stram-q1rqu8
Colored MSA for CFTR-inhibitory-factor_Cif (raw)
MLALGTGATALAVTGSPAAAHPGPHPGPVPSDRELARSLPGGFRSRHARV
GGVRLHYVSGGHGEPLLLVPGWPQTWWAYRKVMPQLARRYHVIAVDLRGM
GGSDKPAGGYDKKTMAADLHALVRGLGHRQVNVAGHDIGSMVAFAFAANH
PEATRKVALLDTPHPDQSEYEMRILCRPGTGTTLWWWAFNQLQALPEQLM
HGRMRHVIDWLYANSLADQSLVGDLDRDIYANAYNSPQAVRAGTRWYQAC
HQDITDQAGYGKLTMPVLGIGGNFTFEDLRNKLTAQATDVHMVRASKSVH
YLPEEEPDVVAGALLDFFG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLALGTGATALAVTGSPAAAHPGPHPGPVPSDRELARSLPGGFRSRHARV
GGVRLHYVSGGHGEPLLLVPGWPQTWWAYRKVMPQLARRYHVIAVDLRGM
GGSDKPAGGYDKKTMAADLHALVRGLGHRQVNVAGHDIGSMVAFAFAANH
PEATRKVALLDTPHPDQSEYEMRILCRPGTGTTLWWWAFNQLQALPEQLM
HGRMRHVIDWLYANSLADQSLVGDLDRDIYANAYNSPQAVRAGTRWYQAC
HQDITDQAGYGKLTMPVLGIGGNFTFEDLRNKLTAQATDVHMVRASKSVH
YLPEEEPDVVAGALLDFFG


References
1 more
    Title: Mutation of an atypical oxirane oxyanion hole improves regioselectivity of the alpha/beta-fold epoxide hydrolase Alp1U
    Zhang L, De BC, Zhang W, Mandi A, Fang Z, Yang C, Zhu Y, Kurtan T, Zhang C
    Ref: Journal of Biological Chemistry, 295:16987, 2020 : PubMed

            

    Title: Multiple biosynthetic and uptake systems mediate siderophore-dependent iron acquisition in Streptomyces coelicolor A3(2) and Streptomyces ambofaciens ATCC 23877
    Barona-Gomez F, Lautru S, Francou FX, Leblond P, Pernodet JL, Challis GL
    Ref: Microbiology, 152:3355, 2006 : PubMed

            

    Title: Intraspecific variability of the terminal inverted repeats of the linear chromosome of Streptomyces ambofaciens
    Choulet F, Gallois A, Aigle B, Mangenot S, Gerbaud C, Truong C, Francou FX, Borges F, Fourrier C and Leblond P <4 more author(s)>
    Ref: Journal of Bacteriology, 188:6599, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer