Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strci-MONAIX

Streptomyces cinnamonensis pks thioesterase

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Streptomyces cinnamonensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces cinnamonensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF440781
1 UniProt : Q846X7
1 UniProt : Q846X7
1 Interpro : Q846X7
1 Prodom : Q846X7
1 Pfam : Q846X7
1 PIRSF : Q846X7
1 SUPERFAM : Q846X7
Sequence
Graphical view for this peptide sequence: strci-MONAIX
Colored MSA for Thioesterase (raw)
MDRGTAARAPQIGDEFGAATGNGVWLRRYHAAAEAPVRLVCFPFAGGSAS
YYFGLSGLLAPGVEVLAVQYPGRQDRHAEPCLASVAELADGVVPHLPCDG
KPFALFGHSLGAIVAFEVARRLRGPAGPGLPVHLFVSGGLARPYRPAGRS
GAFGDADILAHLRAMGGTDERFFRSPELQELVLPALRADYRAVATYEAPG
PGRLDCPITALIGDADERTSPEQAATWRERTGAAFDLRVLPGGHFYLDGC
QEQVAAVVTEALTAGPGV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDRGTAARAPQIGDEFGAATGNGVWLRRYHAAAEAPVRLVCFPFAGGSAS
YYFGLSGLLAPGVEVLAVQYPGRQDRHAEPCLASVAELADGVVPHLPCDG
KPFALFGHSLGAIVAFEVARRLRGPAGPGLPVHLFVSGGLARPYRPAGRS
GAFGDADILAHLRAMGGTDERFFRSPELQELVLPALRADYRAVATYEAPG
PGRLDCPITALIGDADERTSPEQAATWRERTGAAFDLRVLPGGHFYLDGC
QEQVAAVVTEALTAGPGV


Reference
    Title: Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization
    Oliynyk M, Stark CB, Bhatt A, Jones MA, Hughes-Thomas ZA, Wilkinson C, Oliynyk Z, Demydchuk Y, Staunton J, Leadlay PF
    Ref: Molecular Microbiology, 49:1179, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer