Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strco-SC3F7.14

Streptomyces coelicolor RedJ-Thioesterase

Comment
Other strains: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145), Streptomyces lividans TK24


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Streptomyces coelicolor
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces albidoflavus group: N E > Streptomyces coelicolor: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 3QMV, 3QMW
No kinetic





No Substrate
1 inhbitor:
Tetraethylene-glycol
1 Genbank : AL021409
2 UniProt : O54157, D6ENX7
2 Structure : 3QMV, 3QMW
2 UniProt : O54157, D6ENX7
2 Interpro : O54157, D6ENX7
2 Prodom : O54157, D6ENX7
2 Pfam : O54157, D6ENX7
2 PIRSF : O54157, D6ENX7
2 SUPERFAM : O54157, D6ENX7
Sequence
Graphical view for this peptide sequence: strco-SC3F7.14
Colored MSA for Thioesterase (raw)
MSPADLLSQRSAWFPRPVAAPAAEPPDPAAAPLRLVCFPYAGGTVSAFRG
WQERLGDEVAVVPVQLPGRGLRLRERPYDTMEPLAEAVADALEEHRLTHD
YALFGHSMGALLAYEVACVLRRRGAPRPRHLFVSGSRAPHLYGDRADHTL
SDTALREVIRDLGGLDDADTLGAAYFDRRLPVLRADLRACERYDWHPRPP
LDCPTTAFSAAADPIATPEMVEAWRPYTTGSFLRRHLPGNHFFLNGGPSR
DRLLAHLGTELDALGTTPHRKATREATWTF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSPADLLSQRSAWFPRPVAAPAAEPPDPAAAPLRLVCFPYAGGTVSAFRG
WQERLGDEVAVVPVQLPGRGLRLRERPYDTMEPLAEAVADALEEHRLTHD
YALFGHSMGALLAYEVACVLRRRGAPRPRHLFVSGSRAPHLYGDRADHTL
SDTALREVIRDLGGLDDADTLGAAYFDRRLPVLRADLRACERYDWHPRPP
LDCPTTAFSAAADPIATPEMVEAWRPYTTGSFLRRHLPGNHFFLNGGPSR
DRLLAHLGTELDALGTTPHRKATREATWTF


References
    Title: Structure and function of the RedJ protein, a thioesterase from the prodiginine biosynthetic pathway in Streptomyces coelicolor
    Whicher JR, Florova G, Sydor PK, Singh R, Alhamadsheh M, Challis GL, Reynolds KA, Smith JL
    Ref: Journal of Biological Chemistry, 286:22558, 2011 : PubMed

            

    Title: Complete genome sequence of the model actinomycete Streptomyces coelicolor A3(2)
    Bentley SD, Chater KF, Cerdeno-Tarraga AM, Challis GL, Thomson NR, James KD, Harris DE, Quail MA, Kieser H and Hopwood DA <33 more author(s)>
    Ref: Nature, 417:141, 2002 : PubMed

            

    Title: A set of ordered cosmids and a detailed genetic and physical map for the 8 Mb Streptomyces coelicolor A3(2) chromosome
    Redenbach M, Kieser HM, Denapaite D, Eichner A, Cullum J, Kinashi H, Hopwood DA
    Ref: Molecular Microbiology, 21:77, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer