Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strco-SLPD

Streptomyces lividans, and Streptomyces coelicolor proteinase

Comment
Streptomyces coelicolor Q54398 Streptomyces lividans and Q7AKL3 Streptomyces coelicolor have the same sequence


Relationship
Family|Tiancimycin-TnmK-Tripeptidase-HIP
Block| X
Position in NCBI Life Tree|Streptomyces lividans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces lividans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : L42758, AL035636, AL939116
1 UniProt : Q7AKL3
2 UniProt : Q54398, Q7AKL3
2 Interpro : Q54398, Q7AKL3
2 Prodom : Q54398, Q7AKL3
2 Pfam : Q54398, Q7AKL3
2 PIRSF : Q54398, Q7AKL3
2 SUPERFAM : Q54398, Q7AKL3
Sequence
Graphical view for this peptide sequence: strco-SLPD
Colored MSA for Tiancimycin-TnmK-Tripeptidase-HIP (raw)
MDTRRTHRRTRTGGTRFRATLLTAALLATACSAGGASTSAGSPAAKAAGA
TEAATATLTPLPKATPAELSPYYEQKLGWRDCGVPGFQCATMKAPLDYAK
PADGDVRLAVARKKATGPGKRLGSLLVNPGGPGGSAIGYLQQYAGIGYPA
KVRAQYDMVAVDPRGVARSEPVECLDGREMDAYTRTDVTPDDAGETDELV
DAYKEFAEGCGADAPKLLRHVSTVEAARDMDVLRAVLGDEKLTYVGASYG
TFLGATYAGLFPDRTGRLVLDGAMDPSLPARRLNLEQTEGFETAFQSFAK
DCVKQPDCPLGDKDTTPDQVGKNLKSFFDDLDAKPLPAGDADGRKLTESL
ATTGVIAAMYDEGAWQQLRESLTSAIKEKDGAGLLILSDSYYEREADGGY
SNLMFANAAVNCLDLPAAFSSPDEVRDALPDFEKASPVFGEGLAWSSLNC
AYWPVKPTGEPHRIEAAGATPIVVVGTTRDPATPYRWAEALSDQLTSGHL
LTYEGDGHTAYGRGSSCIDSAINTYLLTGTAPEDGKRCS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDTRRTHRRTRTGGTRFRATLLTAALLATACSAGGASTSAGSPAAKAAGA
TEAATATLTPLPKATPAELSPYYEQKLGWRDCGVPGFQCATMKAPLDYAK
PADGDVRLAVARKKATGPGKRLGSLLVNPGGPGGSAIGYLQQYAGIGYPA
KVRAQYDMVAVDPRGVARSEPVECLDGREMDAYTRTDVTPDDAGETDELV
DAYKEFAEGCGADAPKLLRHVSTVEAARDMDVLRAVLGDEKLTYVGASYG
TFLGATYAGLFPDRTGRLVLDGAMDPSLPARRLNLEQTEGFETAFQSFAK
DCVKQPDCPLGDKDTTPDQVGKNLKSFFDDLDAKPLPAGDADGRKLTESL
ATTGVIAAMYDEGAWQQLRESLTSAIKEKDGAGLLILSDSYYEREADGGY
SNLMFANAAVNCLDLPAAFSSPDEVRDALPDFEKASPVFGEGLAWSSLNC
AYWPVKPTGEPHRIEAAGATPIVVVGTTRDPATPYRWAEALSDQLTSGHL
LTYEGDGHTAYGRGSSCIDSAINTYLLTGTAPEDGKRCS


References
    Title: Complete genome sequence of the model actinomycete Streptomyces coelicolor A3(2)
    Bentley SD, Chater KF, Cerdeno-Tarraga AM, Challis GL, Thomson NR, James KD, Harris DE, Quail MA, Kieser H and Hopwood DA <33 more author(s)>
    Ref: Nature, 417:141, 2002 : PubMed

            

    Title: A set of ordered cosmids and a detailed genetic and physical map for the 8 Mb Streptomyces coelicolor A3(2) chromosome
    Redenbach M, Kieser HM, Denapaite D, Eichner A, Cullum J, Kinashi H, Hopwood DA
    Ref: Molecular Microbiology, 21:77, 1996 : PubMed

            

    Title: Isolation and characterization of two genes encoding proteases associated with the mycelium of Streptomyces lividans 66
    Binnie C, Butler MJ, Aphale JS, Bourgault R, DiZonno MA, Krygsman P, Liao L, Walczyk E, Malek LT
    Ref: Journal of Bacteriology, 177:6033, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer