Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strcz-Q84HB8

Streptomyces carzinostaticus subsp. neocarzinostaticus epoxide hydrolase

Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Streptomyces carzinostaticus subsp. neocarzinostaticus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces carzinostaticus: N E > Streptomyces carzinostaticus subsp. neocarzinostaticus: N E


Molecular evidence
Database
No mutation
2 structures: 4I19, 4QA9
No kinetic





No Substrate
No inhibitor
1 Genbank : AY117439
2 Structure : 4I19, 4QA9
1 UniProt : Q84HB8
1 Interpro : Q84HB8
1 Prodom : Q84HB8
1 Pfam : Q84HB8
1 PIRSF : Q84HB8
1 SUPERFAM : Q84HB8
Sequence
Graphical view for this peptide sequence: strcz-Q84HB8
Colored MSA for Epoxide_hydrolase (raw)
MRPFQVQIPQADIDDLKRRLSETRWPELVDVGWSRGAPLSYIKELAEYWR
DGFDWRAAERRINQYPQFTTEIDGATIHFLHVRSPEPDATPMVITHGWPG
TPVEFLDIIGPLTDPRAHGGDPADAFHLVIPSLPGFGLSGPLKSAGWELG
RIAMAWSKLMASLGYERYIAQGGDIGAFTSLLLGAIDPSHLAGIHVNLLQ
TNLSGEPGELETLSDADKARLAVSERFLDDLSGPMKMQSTRPHTIGYMLN
DSPVAQLAYLLEMFKHWAQTENVPEDAVDRDLMLTHISLFWFTATGGSAA
QAHYELKPFLPITSLIGRSPTLDVPMGVAVYPGALFQPVRSLAERDFKQI
VHWAELDRGGHFSAMEEPDLFVDDLRTFNRTLKKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRPFQVQIPQADIDDLKRRLSETRWPELVDVGWSRGAPLSYIKELAEYWR
DGFDWRAAERRINQYPQFTTEIDGATIHFLHVRSPEPDATPMVITHGWPG
TPVEFLDIIGPLTDPRAHGGDPADAFHLVIPSLPGFGLSGPLKSAGWELG
RIAMAWSKLMASLGYERYIAQGGDIGAFTSLLLGAIDPSHLAGIHVNLLQ
TNLSGEPGELETLSDADKARLAVSERFLDDLSGPMKMQSTRPHTIGYMLN
DSPVAQLAYLLEMFKHWAQTENVPEDAVDRDLMLTHISLFWFTATGGSAA
QAHYELKPFLPITSLIGRSPTLDVPMGVAVYPGALFQPVRSLAERDFKQI
VHWAELDRGGHFSAMEEPDLFVDDLRTFNRTLKKL


References
    Title: Characterization of the epoxide hydrolase NcsF2 from the neocarzinostatin biosynthetic gene cluster
    Lin S, Horsman GP, Shen B
    Ref: Org Lett, 12:3816, 2010 : PubMed

            

    Title: The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases
    Liu W, Nonaka K, Nie L, Zhang J, Christenson SD, Bae J, Van Lanen SG, Zazopoulos E, Farnet CM and Shen B <1 more author(s)>
    Ref: Chemical Biology, 12:293, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer