Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strgn-asp2

Streptococcus gordonii; Streptococcus sp. Accessory Sec system protein Asp2. Orf2

Comment
Other strains: Streptococcus gordonii; Streptococcus sp.


Relationship
Family|Asp2
Block| X
Position in NCBI Life Tree|Streptococcus gordonii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Streptococcus: N E > Streptococcus gordonii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: strgn-asp2
Colored MSA for Asp2 (raw)
MKNKLKILQIGSIDWSKEVVIPDNMDWYYFFSLTLRLAIKKVMEMEKINH
FSAIIVDDLDLIPDLFLIESRIIPYTIFYSKKQQAIQEPIAFFLKRYCAQ
QIDLSDRPNLLRKLSKALFRGQYGDKMTPLDMVVSPGFKGRICHNGYENL
ELEGNFGSDFRPIVSWKYNIVASKKNPVEIWLEYEKDLSCELRLRIYNIQ
EGSAADLVRESVFSETDMEETIVLDNDFTSFLGITLEARGFGTLKIGAFH
QRLTRYQFGKFVLGGKILKDSHRQEINYFFYPGDFKPPLVVYFSGYRRAE
GFEGFGMMRGLGCPFLLISDQRLDGGVFYLGSDELEEGIRRIIQEHMELL
GFSERELILSGISMGTYGAAYYGADFSPRAIILCKPLANLGTIAQRGRLR
LPEVFPMALDILHRHTGGKDRENVMELDNRYWKKFKKADFSRTIFGLAYM
KEEDYDPTAYEDLVQYLYPTETQLMSNGLSGRHNDDSTMVINWFMNYHRI
ILEKEFGRKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKNKLKILQIGSIDWSKEVVIPDNMDWYYFFSLTLRLAIKKVMEMEKINH
FSAIIVDDLDLIPDLFLIESRIIPYTIFYSKKQQAIQEPIAFFLKRYCAQ
QIDLSDRPNLLRKLSKALFRGQYGDKMTPLDMVVSPGFKGRICHNGYENL
ELEGNFGSDFRPIVSWKYNIVASKKNPVEIWLEYEKDLSCELRLRIYNIQ
EGSAADLVRESVFSETDMEETIVLDNDFTSFLGITLEARGFGTLKIGAFH
QRLTRYQFGKFVLGGKILKDSHRQEINYFFYPGDFKPPLVVYFSGYRRAE
GFEGFGMMRGLGCPFLLISDQRLDGGVFYLGSDELEEGIRRIIQEHMELL
GFSERELILSGISMGTYGAAYYGADFSPRAIILCKPLANLGTIAQRGRLR
LPEVFPMALDILHRHTGGKDRENVMELDNRYWKKFKKADFSRTIFGLAYM
KEEDYDPTAYEDLVQYLYPTETQLMSNGLSGRHNDDSTMVINWFMNYHRI
ILEKEFGRKK


References
    Title: Asp2 and Asp3 interact directly with GspB, the export substrate of the Streptococcus gordonii accessory Sec System
    Yen YT, Seepersaud R, Bensing BA, Sullam PM
    Ref: Journal of Bacteriology, 193:3165, 2011 : PubMed

            

    Title: Genes in the accessory sec locus of Streptococcus gordonii have three functionally distinct effects on the expression of the platelet-binding protein GspB
    Takamatsu D, Bensing BA, Sullam PM
    Ref: Molecular Microbiology, 52:189, 2004 : PubMed

            

    Title: An accessory sec locus of Streptococcus gordonii is required for export of the surface protein GspB and for normal levels of binding to human platelets
    Bensing BA, Sullam PM
    Ref: Molecular Microbiology, 44:1081, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer