Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strhe-ShHTL5

Striga hermonthica (Purple witchweed) (Buchnera hermonthica) hyposensitive to light 5. Strigolactone receptor 5 ShHTL5

Relationship
Family|RsbQ-like
Block| X
Position in NCBI Life Tree|Striga hermonthica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Lamiales: N E > Orobanchaceae: N E > Buchnereae: N E > Striga: N E > Striga hermonthica: N E


Molecular evidence
Database
No mutation
2 structures: 5CBK, 8DVC
No kinetic





No Substrate
No inhibitor
2 Genbank : ALB07160, KR013125
2 Structure : 8DVC, 5CBK
Sequence
Graphical view for this peptide sequence: strhe-ShHTL5
Colored MSA for RsbQ-like (raw)
MSTVGSAHNVTVLGSGETTVVLGHGFGTDQSVWKYLVPHLTDDYRVLLYD
NMGAGTTDPNLYDFERYSSLEGHSQDLIAILEEFHVTKCIFVGHSLSSMV
GAVSSIFRPDLFRKIVMISACPRVANADDYYGGFEEEDVNQLYGAMEENF
QTMMTGYAPIVVGGDLESEAMQEFSRTLFNMRPDIALSICRMISGYDLRP
YLGLVVIPCHIIQSSKDKLVPVAVAEYLHRNFGGKSVVELIPTEGHLPHL
SAPDITIPVLIRHINQDIADD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSTVGSAHNVTVLGSGETTVVLGHGFGTDQSVWKYLVPHLTDDYRVLLYD
NMGAGTTDPNLYDFERYSSLEGHSQDLIAILEEFHVTKCIFVGHSLSSMV
GAVSSIFRPDLFRKIVMISACPRVANADDYYGGFEEEDVNQLYGAMEENF
QTMMTGYAPIVVGGDLESEAMQEFSRTLFNMRPDIALSICRMISGYDLRP
YLGLVVIPCHIIQSSKDKLVPVAVAEYLHRNFGGKSVVELIPTEGHLPHL
SAPDITIPVLIRHINQDIADD


References
    Title: Structure-function analysis identifies highly sensitive strigolactone receptors in Striga
    Toh S, Holbrook-Smith D, Stogios PJ, Onopriyenko O, Lumba S, Tsuchiya Y, Savchenko A, McCourt P
    Ref: Science, 350:203, 2015 : PubMed

            

    Title: PARASITIC PLANTS. Probing strigolactone receptors in Striga hermonthica with fluorescence
    Tsuchiya Y, Yoshimura M, Sato Y, Kuwata K, Toh S, Holbrook-Smith D, Zhang H, McCourt P, Itami K and Hagihara S <1 more author(s)>
    Ref: Science, 349:864, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer