Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strhy-FKBQ

Streptomyces hygroscopicus var. ascomyceticus fkbq

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Streptomyces hygroscopicus var. ascomyceticus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces hygroscopicus: N E > Streptomyces hygroscopicus subsp. ascomyceticus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF235504
1 UniProt : Q9KID3
1 Interpro : Q9KID3
1 Prodom : Q9KID3
1 Pfam : Q9KID3
1 PIRSF : Q9KID3
1 SUPERFAM : Q9KID3
Sequence
Graphical view for this peptide sequence: strhy-FKBQ
Colored MSA for Thioesterase (raw)
MSSELWLRQFFPTPEAPVRVVLLPHAGGSATFYLPLARALAPVADVYAVQ
YPGRQDRRDEEAVRDLRVLAGLVAEALKPGLDRPLVLFGHSMGATLAFEL
AQRLPVAHLIVSGRRAPSQPRADQDHLASDDELLAAVIGLGGTSADVMAD
DEMRALILAPLRADYYAAETYRWEPAPPLETPITVCIGDDDPKTTVEQAH
AWAGHTTAPTTVEVFPGGHFYLVDHQERVAELVAQGVRRVAPGAVGS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSSELWLRQFFPTPEAPVRVVLLPHAGGSATFYLPLARALAPVADVYAVQ
YPGRQDRRDEEAVRDLRVLAGLVAEALKPGLDRPLVLFGHSMGATLAFEL
AQRLPVAHLIVSGRRAPSQPRADQDHLASDDELLAAVIGLGGTSADVMAD
DEMRALILAPLRADYYAAETYRWEPAPPLETPITVCIGDDDPKTTVEQAH
AWAGHTTAPTTVEVFPGGHFYLVDHQERVAELVAQGVRRVAPGAVGS


Reference
    Title: The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units
    Wu K, Chung L, Revill WP, Katz L, Reeves CD
    Ref: Gene, 251:81, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer