Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strlu-c0l0l7

Streptomyces laurentii. TsrB TsrI protein

Comment
An alpha/beta-hydrolase fold protein in the biosynthesis of thiostrepton exhibits a dual activity for endopeptidyl hydrolysis and epoxide ring opening/macrocyclization


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Streptomyces laurentii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces laurentii: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : FJ652572, FJ436358, AP017424
2 UniProt : C0L0L7, C0JRY8
2 UniProt : C0L0L7, C0JRY8
2 Interpro : C0L0L7, C0JRY8
2 Prodom : C0L0L7, C0JRY8
2 Pfam : C0L0L7, C0JRY8
2 PIRSF : C0L0L7, C0JRY8
2 SUPERFAM : C0L0L7, C0JRY8
Sequence
Graphical view for this peptide sequence: strlu-c0l0l7
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MRPVILVHGLLGTEDAHYAGCRKWWTRPVTEIRLPGHGTGGEIPPHPAAA
AIDRVREAIREQPEPPVVVGLSYLGAAVAFRAAAGFPATVAGIVMSGYSF
LVSPDTLNRWLAGFTRMASHQPAAQRHFAELHGPTWENLLTATFAELSDG
CLRLPGVADLEHLPVPVQLVNGSLLQNERNAIGPAAAAGADVAVIAGAGH
VVPMDAPRVFAATVEDFADRVTAGRTAFHERRRAAERAAAEPAVPPEAGT
GTEPVARKAATHG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRPVILVHGLLGTEDAHYAGCRKWWTRPVTEIRLPGHGTGGEIPPHPAAA
AIDRVREAIREQPEPPVVVGLSYLGAAVAFRAAAGFPATVAGIVMSGYSF
LVSPDTLNRWLAGFTRMASHQPAAQRHFAELHGPTWENLLTATFAELSDG
CLRLPGVADLEHLPVPVQLVNGSLLQNERNAIGPAAAAGADVAVIAGAGH
VVPMDAPRVFAATVEDFADRVTAGRTAFHERRRAAERAAAEPAVPPEAGT
GTEPVARKAATHG


References
1 more
    Title: An alpha/beta-hydrolase fold protein in the biosynthesis of thiostrepton exhibits a dual activity for endopeptidyl hydrolysis and epoxide ring opening/macrocyclization
    Zheng Q, Wang S, Duan P, Liao R, Chen D, Liu W
    Ref: Proc Natl Acad Sci U S A, 113:14318, 2016 : PubMed

            

    Title: Thiostrepton biosynthesis: prototype for a new family of bacteriocins
    Kelly WL, Pan L, Li C
    Ref: Journal of the American Chemical Society, 131:4327, 2009 : PubMed

            

    Title: Thiopeptide biosynthesis featuring ribosomally synthesized precursor peptides and conserved posttranslational modifications
    Liao R, Duan L, Lei C, Pan H, Ding Y, Zhang Q, Chen D, Shen B, Yu Y, Liu W
    Ref: Chemical Biology, 16:141, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer