Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strm6-d3haj3

Streptococcus mitis (strain B6). Uncharacterized protein

Relationship
Family|Asp2
Block| X
Position in NCBI Life Tree|Streptococcus mitis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Streptococcus: N E > Streptococcus mitis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : FN568063, WP_012972582, YP_003446753
1 UniProt : D3HAJ3
1 UniProt : D3HAJ3
1 Interpro : D3HAJ3
1 Pfam : D3HAJ3
1 PIRSF : D3HAJ3
1 SUPERFAM : D3HAJ3
Sequence
Graphical view for this peptide sequence: strm6-d3haj3
Colored MSA for Asp2 (raw)
MSWYHFYPNSSKALREIIDKEDISRFHAVLIEDGQYAKDLFSFVKYFEPY
TLFYNQNLQINDREVVNFLKKRCAQAIDFSSPQQLINDLSTSLFGGGYGD
KLFPSTIQVNPNFTGAISYQGLDYVSLEGEFGDTFSQLAYWSYNIMVSKN
LPIELWLEYEKQGNCELRLVIRKIWSGSVDDVFEETIVTENDLENALIME
NKEGDCYLAISVEARGHGTIKLGNLHQRWSRKQFGKFVLGGNILHDSKRD
EINYFFHPGNFKPPLAVYFAGYRPAEGFEGYFMMKNLGCPFILFSDPRLE
GGAFYLGTDELEGKVKETIAHYLDYLGFDRKDLILSGLSMGTFPALYYGA
SFEPHAIIVGKPLANLGTIASRGRLDAPGVSNLAFDCLIHHTGGTSWQDM
TELDQRFWKIFKQANFSKTTFGLSYMKDEEMDPQAYEKLVTYLCNTGAKI
LSKGTAGRHNDDTDTNVAWFIHFYRMVLASGFGREKE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSWYHFYPNSSKALREIIDKEDISRFHAVLIEDGQYAKDLFSFVKYFEPY
TLFYNQNLQINDREVVNFLKKRCAQAIDFSSPQQLINDLSTSLFGGGYGD
KLFPSTIQVNPNFTGAISYQGLDYVSLEGEFGDTFSQLAYWSYNIMVSKN
LPIELWLEYEKQGNCELRLVIRKIWSGSVDDVFEETIVTENDLENALIME
NKEGDCYLAISVEARGHGTIKLGNLHQRWSRKQFGKFVLGGNILHDSKRD
EINYFFHPGNFKPPLAVYFAGYRPAEGFEGYFMMKNLGCPFILFSDPRLE
GGAFYLGTDELEGKVKETIAHYLDYLGFDRKDLILSGLSMGTFPALYYGA
SFEPHAIIVGKPLANLGTIASRGRLDAPGVSNLAFDCLIHHTGGTSWQDM
TELDQRFWKIFKQANFSKTTFGLSYMKDEEMDPQAYEKLVTYLCNTGAKI
LSKGTAGRHNDDTDTNVAWFIHFYRMVLASGFGREKE


Reference
    Title: The genome of Streptococcus mitis B6--what is a commensal?
    Denapaite D, Bruckner R, Nuhn M, Reichmann P, Henrich B, Maurer P, Schahle Y, Selbmann P, Zimmermann W and Hakenbeck R <1 more author(s)>
    Ref: PLoS ONE, 5:e9426, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer