Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strpn-AXE1

Streptococcus pneumoniae , Streptococcus mitis, S. oralis, S. sanguinis, xylan esterase 1 (EC 3.1.1.-)

Comment
Other strains: Streptococcus pneumoniae (strains ATCC BAA-255 / R6; SP14-BS69; GA04375; serotype 19F (strain G54); AP200; SP11-BS70; MLV-016; SP9-BS68; SP195; P1031; CDC1087-00; SP14-BS69; SP18-BS74; 670-6B; SP6-BS73; serotype A19 (strain TCH8431); ATCC 700669 / Spain 23F-1; CDC3059-06; JJA; serotype 1 (strain INV104); SP23-BS72; GA04375; Hungary19A-6; SP14-BS292; BS397; BS455; SP-BS293; SP-BS293; 70585; SP19-BS75; BS457; serotype 14 (strain INV200); BS458; CGSP14; CDC0288-04; SP3-BS71; serotype 3 (strain OXC141); serotype 2 (strain D39 / NCTC 7466); CDC1873-00, Streptococcus mitis (SK564; SK597; SK321; B6; NCTC 12261; ATCC 6249); Streptococcus oralis (ATCC 35037; ATCC 35037; Uo5) Streptococcus sanguinis ATCC 49296; Streptococcus sp. (M143; C300; oral taxon 071 str. 73H25AP; M334)


Relationship
Family|Acetyl-esterase_deacetylase
Block| X
Position in NCBI Life Tree|Streptococcus pneumoniae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Streptococcus: N E > Streptococcus pneumoniae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 49 more: AE008522, ABAD01000002, AE007462
>3 UniProt links 15 more: A5M5U1, A5M5U2, A5LN15
>3 UniProt links 16 more: Q8DNU1, A5M5U1, A5M5U2
>3 Interpro links 16 more: Q8DNU1, A5M5U1, A5M5U2
>3 Pfam links 16 more: Q8DNU1, A5M5U1, A5M5U2
>3 PIRSF links 16 more: Q8DNU1, A5M5U1, A5M5U2
>3 SUPERFAM links 16 more: Q8DNU1, A5M5U1, A5M5U2
Sequence
Graphical view for this peptide sequence: strpn-AXE1
Colored MSA for Acetyl-esterase_deacetylase (raw)
MKNPALLEEIKTYRGRDEVPEDFDAFWDGEVKNVSTLPSYHLEERDFHIP
QVKCYELTFEGSKEGKVYARIVLPKSEEKVPLIFHFHGYMGRGWDWADML
GFTVAGYGVVSMDVRGQSGYSQDGLRSPLGNTVKGHIIRGAVEGRDHLFY
KDVYLDIYQLVEIVASLSQVDEKRLSSYGASQGGALALVAAALNPRIQKT
VAIYPFLSDFRRVIEIGNTSEAYDELFRYFKFYDPFHETEEEIMATLAYI
DVKNLAHRIQGEVKMITGLDDDVCYPITQFAIYNRLTCDKTYRIMPEYAH
EAMNVFVNDQVYNWLCGSEIPFKYLK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKNPALLEEIKTYRGRDEVPEDFDAFWDGEVKNVSTLPSYHLEERDFHIP
QVKCYELTFEGSKEGKVYARIVLPKSEEKVPLIFHFHGYMGRGWDWADML
GFTVAGYGVVSMDVRGQSGYSQDGLRSPLGNTVKGHIIRGAVEGRDHLFY
KDVYLDIYQLVEIVASLSQVDEKRLSSYGASQGGALALVAAALNPRIQKT
VAIYPFLSDFRRVIEIGNTSEAYDELFRYFKFYDPFHETEEEIMATLAYI
DVKNLAHRIQGEVKMITGLDDDVCYPITQFAIYNRLTCDKTYRIMPEYAH
EAMNVFVNDQVYNWLCGSEIPFKYLK


References
7 more
    Title: Annotated draft genomic sequence from a Streptococcus pneumoniae type 19F clinical isolate
    Dopazo J, Mendoza A, Herrero J, Caldara F, Humbert Y, Friedli L, Guerrier M, Grand-Schenk E, Gandin C and Garcia-Bustos JF <6 more author(s)>
    Ref: Microb Drug Resist, 7:99, 2001 : PubMed

            

    Title: Genome of the bacterium Streptococcus pneumoniae strain R6
    Hoskins J, Alborn WE, Jr., Arnold J, Blaszczak LC, Burgett S, DeHoff BS, Estrem ST, Fritz L, Fu DJ and Glass JI <32 more author(s)>
    Ref: Journal of Bacteriology, 183:5709, 2001 : PubMed

            

    Title: Complete genome sequence of a virulent isolate of Streptococcus pneumoniae
    Tettelin H, Nelson KE, Paulsen IT, Eisen JA, Read TD, Peterson S, Heidelberg J, DeBoy RT, Haft DH and Fraser CM <29 more author(s)>
    Ref: Science, 293:498, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer