Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strsw-c9ysy7

Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative uncharacterized protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Streptomyces scabies
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces scabiei: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FN554889
1 UniProt : C9YSY7
1 UniProt : C9YSY7
1 Interpro : C9YSY7
1 Prodom : C9YSY7
1 Pfam : C9YSY7
1 PIRSF : C9YSY7
1 SUPERFAM : C9YSY7
Sequence
Graphical view for this peptide sequence: strsw-c9ysy7
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MTSEGQPRRRVLGGLLAAGAVTLTAAPAAAAAPSGSGSKPTVVLVHGVFA
DSSGWNDVIARLLKAGFPVIAPANPLRDLADDSAYVSSVVGSISGPVILV
GHSYGGEVVTNAGRGHAHVKALVYVGAFAPDEGESALQLAGMFPGSELPD
ALVTRPFPLPDGTTGTDGYIDPAKFHRVFAADLPVSVTRLMAATQRPGSV
GGLASASGVPAWKSLPSWYVIPTADKVIPAAAQRFMAKRARSSAVEVKGA
SHVVMMSHPDVVVRQITTAYRATR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTSEGQPRRRVLGGLLAAGAVTLTAAPAAAAAPSGSGSKPTVVLVHGVFA
DSSGWNDVIARLLKAGFPVIAPANPLRDLADDSAYVSSVVGSISGPVILV
GHSYGGEVVTNAGRGHAHVKALVYVGAFAPDEGESALQLAGMFPGSELPD
ALVTRPFPLPDGTTGTDGYIDPAKFHRVFAADLPVSVTRLMAATQRPGSV
GGLASASGVPAWKSLPSWYVIPTADKVIPAAAQRFMAKRARSSAVEVKGA
SHVVMMSHPDVVVRQITTAYRATR


Reference
    Title: Streptomyces scabies 87-22 contains a coronafacic acid-like biosynthetic cluster that contributes to plant-microbe interactions
    Bignell DR, Seipke RF, Huguet-Tapia JC, Chambers AH, Parry RJ, Loria R
    Ref: Mol Plant Microbe Interact, 23:161, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer