Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strt2-q5m420

Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (strain CNRZ 1066) (strain ATCC BAA-491 / LMD-9) Streptococcus salivarius SK126 esterase

Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Streptococcus thermophilus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Streptococcus: N E > Streptococcus thermophilus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: CP000024, CP000023, ACLO01000006
1 UniProt : Q5M420
1 UniProt : Q5M420
1 Interpro : Q5M420
1 Prodom : Q5M420
1 Pfam : Q5M420
1 PIRSF : Q5M420
1 SUPERFAM : Q5M420
Sequence
Graphical view for this peptide sequence: strt2-q5m420
Colored MSA for A85-EsteraseD-FGH (raw)
MAFFQIEYSSVVLGQYRQVDVIYPDRDQIAETESDTDIPVLYLLHGMGGN
HNSWAFRTNIQRLLRKTNLIVIMPNSENGWYTNTKYGVRYYDAIAKELPQ
VMQRFFPSMTKKRKKTFIAGLSMGGYGSFKIALTTNNFACAGSFSGALGL
STEMIRDETIESKEYWQGVFGDLEGKDIEQHKLVNLAKQHDKKTKFFAWC
GLEDFLFDTQDQAVADLKALGLDIDYSTDHGRHEWYYWEKQLEAYLEWLP
IDYIKEERLS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAFFQIEYSSVVLGQYRQVDVIYPDRDQIAETESDTDIPVLYLLHGMGGN
HNSWAFRTNIQRLLRKTNLIVIMPNSENGWYTNTKYGVRYYDAIAKELPQ
VMQRFFPSMTKKRKKTFIAGLSMGGYGSFKIALTTNNFACAGSFSGALGL
STEMIRDETIESKEYWQGVFGDLEGKDIEQHKLVNLAKQHDKKTKFFAWC
GLEDFLFDTQDQAVADLKALGLDIDYSTDHGRHEWYYWEKQLEAYLEWLP
IDYIKEERLS


References
    Title: Comparative genomics of the lactic acid bacteria
    Makarova K, Slesarev A, Wolf Y, Sorokin A, Mirkin B, Koonin E, Pavlov A, Pavlova N, Karamychev V and Mills D <40 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 103:15611, 2006 : PubMed

            

    Title: Complete sequence and comparative genome analysis of the dairy bacterium Streptococcus thermophilus
    Bolotin A, Quinquis B, Renault P, Sorokin A, Ehrlich SD, Kulakauskas S, Lapidus A, Goltsman E, Mazur M and Hols P <13 more author(s)>
    Ref: Nat Biotechnol, 22:1554, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer