Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strtr-pepx

Streptococcus thermophilus, Streptococcus salivarius, Streptococcus sp., Streptococcus vestibularis, Xaa-Pro dipeptidyl-peptidase (x-prolyl-dipeptidyl aminopeptidase) (x-pdap)

Comment
Other strains: Streptococcus thermophilus (strains CNRZ 1066; ATCC BAA-250 / LMG 18311; ATCC BAA-491 / LMD-9; ND03), Streptococcus salivarius SK126, Streptococcus sp. C150, Streptococcus vestibularis (strains: ATCC 49124; F0396)


Relationship
Family|Lactobacillus_peptidase
Block| X
Position in NCBI Life Tree|Streptococcus thermophilus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Streptococcus: N E > Streptococcus thermophilus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: CP000023, CP000024, AY055853
>3 UniProt links 4 more: Q8GMC0, Q5LYA9, Q5M2X3
>3 UniProt links 4 more: Q8GMC0, Q5LYA9, Q5M2X3
>3 Interpro links 4 more: Q8GMC0, Q5LYA9, Q5M2X3
>3 Prodom links 4 more: Q8GMC0, Q5LYA9, Q5M2X3
>3 Pfam links 4 more: Q8GMC0, Q5LYA9, Q5M2X3
>3 PIRSF links 4 more: Q8GMC0, Q5LYA9, Q5M2X3
>3 SUPERFAM links 4 more: Q8GMC0, Q5LYA9, Q5M2X3
Sequence
Graphical view for this peptide sequence: strtr-pepx
Colored MSA for Lactobacillus_peptidase (raw)
MKFNQFSYIPVSPETAYQELRSLGFEVSLDASAKANFESFVRKYFLFFED
TDLALKNWIADPETDLLSFFQSDRPLTAEVFGLVALQLLGFVPNVDFTDS
VAFLEKMAFPIAFDGSLNNLHQLLATRTQSGNTLIDQLVAQDLIPISNDY
VFFNGKSLATFDTNQLHREVVYVETPVDTDKDGLLDLVKVTILRPNVDFP
VPAMMTASPYQQGTNEPSSDKLTHKMEGDLLVKPAGKISLSRPEIKAPEA
DLTPINPVTKAEERFAHTDTYTLNDYMLARGVASIYVSGVGTFNSEGFMT
SGDYQQVLAYKAVIDWLNGRARAFTSRSRQHTITADWASGKVTTTGLSYL
GTMSNALATTGVDGLEMVIAEAGISSWYDYYRENGLLVSPGGYPGEDLDT
LTEFTYSRALLAGEYLRHQKDYEAYLNELSTAIDRKHGDYNQFWHDRNYV
QFADRVKATVVFTHGSQDWNVKPINVYQMFRALPKSLEKHLFFHNGAHVY
MNAWQSIDFRESMNALICQKLLGLDNGYTLPTVIWQNNQSEQTWEVLDNF
GHDNGKHIQLGKSEASIANHYEEEIFAKYGKAYQSFKDDLFMDKANAITL
DFELDQDIQINGRVHLELRVKSSTNRGLISAQVLEMGDKKYLAPIPELKR
MSLDNGRLFKEEALRELPFKQAKYRVITKGHLNLQNRKDLLSIENVTPNE
WMTIGLDLQPTIYKPNKGDKLRLVLYTTDFEHTIRDNSDYEVTVDLSQSK
MTLPY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFNQFSYIPVSPETAYQELRSLGFEVSLDASAKANFESFVRKYFLFFED
TDLALKNWIADPETDLLSFFQSDRPLTAEVFGLVALQLLGFVPNVDFTDS
VAFLEKMAFPIAFDGSLNNLHQLLATRTQSGNTLIDQLVAQDLIPISNDY
VFFNGKSLATFDTNQLHREVVYVETPVDTDKDGLLDLVKVTILRPNVDFP
VPAMMTASPYQQGTNEPSSDKLTHKMEGDLLVKPAGKISLSRPEIKAPEA
DLTPINPVTKAEERFAHTDTYTLNDYMLARGVASIYVSGVGTFNSEGFMT
SGDYQQVLAYKAVIDWLNGRARAFTSRSRQHTITADWASGKVTTTGLSYL
GTMSNALATTGVDGLEMVIAEAGISSWYDYYRENGLLVSPGGYPGEDLDT
LTEFTYSRALLAGEYLRHQKDYEAYLNELSTAIDRKHGDYNQFWHDRNYV
QFADRVKATVVFTHGSQDWNVKPINVYQMFRALPKSLEKHLFFHNGAHVY
MNAWQSIDFRESMNALICQKLLGLDNGYTLPTVIWQNNQSEQTWEVLDNF
GHDNGKHIQLGKSEASIANHYEEEIFAKYGKAYQSFKDDLFMDKANAITL
DFELDQDIQINGRVHLELRVKSSTNRGLISAQVLEMGDKKYLAPIPELKR
MSLDNGRLFKEEALRELPFKQAKYRVITKGHLNLQNRKDLLSIENVTPNE
WMTIGLDLQPTIYKPNKGDKLRLVLYTTDFEHTIRDNSDYEVTVDLSQSK
MTLPY


References
1 more
    Title: Comparative genomics of the lactic acid bacteria
    Makarova K, Slesarev A, Wolf Y, Sorokin A, Mirkin B, Koonin E, Pavlov A, Pavlova N, Karamychev V and Mills D <40 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 103:15611, 2006 : PubMed

            

    Title: Complete sequence and comparative genome analysis of the dairy bacterium Streptococcus thermophilus
    Bolotin A, Quinquis B, Renault P, Sorokin A, Ehrlich SD, Kulakauskas S, Lapidus A, Goltsman E, Mazur M and Hols P <13 more author(s)>
    Ref: Nat Biotechnol, 22:1554, 2004 : PubMed

            

    Title: Cloning and sequencing of the gene encoding X-prolyl-dipeptidyl aminopeptidase (PepX) from Streptococcus thermophilus strain ACA-DC 4
    Anastasiou R, Papadelli M, Georgalaki MD, Kalantzopoulos G, Tsakalidou E
    Ref: J Appl Microbiol, 93:52, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer