strve-PIKAIV

 
Streptomyces venezuelae type I polyketide synthase PikAIV

Relationship
Block X
Streptomyces venezuelae position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces venezuelae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
7 structures (e.g. : 2H7X, 2H7Y, 2HFJ... more)
No kinetic

Substrate: 10-Deoxymethynolide ,
Inhibitor: PSX , PSK , Phosphopentaketide-11 ,
1 Genbank : AF079138
1 UniProt : Q9ZGI2
>3 Structure links 4 more: 2H7X, 2H7Y, 2HFJ
1 UniProtTrembl : Q9ZGI2
1 Interpro : Q9ZGI2
1 Prodom : Q9ZGI2
1 Pfam : Q9ZGI2
1 PIRSF : Q9ZGI2
1 SUPERFAM : Q9ZGI2
1 QuickSwissBlast : Q9ZGI2
 
Sequence
Graphical view for this peptide sequence: strve-PIKAIV
Colored MSA for Thioesterase (raw)
SGADTGAGAGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFASPEACSE
RLDPVLLAGGPTDRAEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFL
AVPLPGYGTGTGTGTALLPADLDTALDAQARAILRAAGDAPVVLLGHSGG
ALLAHELAFRLERAHGAPPAGIVLVDPYPPGHQEPIEVWSRQLGEGLFAG
ELEPMSDARLLAMGRYARFLAGPRPGRSSAPVLLVRASEPLGDWQEERGD
WRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDAIEGIEGAGK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SGADTGAGAGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFASPEACSE
RLDPVLLAGGPTDRAEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFL
AVPLPGYGTGTGTGTALLPADLDTALDAQARAILRAAGDAPVVLLGHSGG
ALLAHELAFRLERAHGAPPAGIVLVDPYPPGHQEPIEVWSRQLGEGLFAG
ELEPMSDARLLAMGRYARFLAGPRPGRSSAPVLLVRASEPLGDWQEERGD
WRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDAIEGIEGAGK

no DNA




References
9 more
    Title: Identification of a Thioesterase Bottleneck in the Pikromycin Pathway through Full-Module Processing of Unnatural Pentaketides
    Hansen DA, Koch AA, Sherman DH
    Ref: Journal of the American Chemical Society, 139:13450, 2017 : PubMed

            

    Title: Insights into channel architecture and substrate specificity from crystal structures of two macrocycle-forming thioesterases of modular polyketide synthases
    Tsai SC, Lu H, Cane DE, Khosla C, Stroud RM
    Ref: Biochemistry, 41:12598, 2002 : PubMed

            

    Title: A gene cluster for macrolide antibiotic biosynthesis in streptomyces venezuelae: architecture of metabolic diversity.
    Xue Y, Zhao L, Liu Hw, Sherman DH
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 95:12111, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer