Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sulsh-q5nu42

Sulfolobus shibatae carboxylesterase

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Sulfolobus shibatae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > TACK group: N E > Crenarchaeota: N E > Thermoprotei: N E > Sulfolobales: N E > Sulfolobaceae: N E > Sulfolobus: N E > Sulfolobus shibatae: N E


Molecular evidence
Database
No mutation
2 structures: 3WJ1, 4P9N
No kinetic





No Substrate
No inhibitor
1 Genbank : AB166870
1 UniProt : Q5NU42
2 Structure : 3WJ1, 4P9N
1 UniProt : Q5NU42
1 Interpro : Q5NU42
1 Prodom : Q5NU42
1 Pfam : Q5NU42
1 PIRSF : Q5NU42
1 SUPERFAM : Q5NU42
Sequence
Graphical view for this peptide sequence: sulsh-q5nu42
Colored MSA for Hormone-sensitive_lipase_like (raw)
MPLDPRIKKLLESGFVVPIGKASVDEVRKIFRQLASAAPKAEVRKVEDIK
IPGSETSINARVYFPKAKGPYGVLVYLHGGGFVIGDVESYDPLCRAITNA
CNCVVVSVDYRLAPEYKFPSAVIDSFDATNWIYNNLDKFDGEMGIAIAGD
SAGGNLAAVVALLSKGKLDLKYQILIYPAVGFDSVSRSMIEYSDGFFLTR
EHIEWFGSQYLRSPADLLDFRFSPIIAQDLSGLPPALIITAEYDPLRDQG
EAYANRLLQAGVPVTSVRFNNVIHGFLSFFPLIDQGKDAIGLIGSVLRRT
FYDKS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPLDPRIKKLLESGFVVPIGKASVDEVRKIFRQLASAAPKAEVRKVEDIK
IPGSETSINARVYFPKAKGPYGVLVYLHGGGFVIGDVESYDPLCRAITNA
CNCVVVSVDYRLAPEYKFPSAVIDSFDATNWIYNNLDKFDGEMGIAIAGD
SAGGNLAAVVALLSKGKLDLKYQILIYPAVGFDSVSRSMIEYSDGFFLTR
EHIEWFGSQYLRSPADLLDFRFSPIIAQDLSGLPPALIITAEYDPLRDQG
EAYANRLLQAGVPVTSVRFNNVIHGFLSFFPLIDQGKDAIGLIGSVLRRT
FYDKS


References
    Title: Structural Insights into the Low pH Adaptation of a Unique Carboxylesterase from Ferroplasma: Altering the pH optima of two carboxylesterases
    Ohara K, Unno H, Oshima Y, Hosoya M, Fujino N, Hirooka K, Takahashi S, Yamashita S, Kusunoki M, Nakayama T
    Ref: Journal of Biological Chemistry, 289:24499, 2014 : PubMed

            

    Title: Molecular cloning and characterization of a thermostable carboxylesterase from an archaeon, Sulfolobus shibatae DSM5389: non-linear kinetic behavior of a hormone-sensitive lipase family enzyme
    Ejima K, Liu J, Oshima Y, Hirooka K, Shimanuki S, Yokota Y, Hemmi H, Nakayama T, Nishino T
    Ref: J Biosci Bioeng, 98:445, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer