Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sulto-ST0071

Sulfolobus tokodaii putative esterase

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Sulfolobus tokodaii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > TACK group: N E > Crenarchaeota: N E > Thermoprotei: N E > Sulfolobales: N E > Sulfolobaceae: N E > Sulfolobus: N E > Sulfolobus tokodaii: N E


Molecular evidence
Database
No mutation
5 structures (e.g. : 3AIK, 3AIL, 3AIM... more)
No kinetic





No Substrate
1 inhbitor:
Paraoxon
1 Genbank : AP000981
>3 Structure links 2 more: 3AIK, 3AIL, 3AIM
1 UniProt : Q976W8
1 Interpro : Q976W8
1 Prodom : Q976W8
1 Pfam : Q976W8
1 PIRSF : Q976W8
1 SUPERFAM : Q976W8
Sequence
Graphical view for this peptide sequence: sulto-ST0071
Colored MSA for Hormone-sensitive_lipase_like (raw)
MIDPKIKKLLESTIQLPIGKASVEEIRSLFKQFSSLTPREEVGKIEDITI
PGSETNIKARVYYPKTQGPYGVLVYYHGGGFVLGDIESYDPLCRAITNSC
QCVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFNGKYGIAVGGDS
AGGNLAAVTAILSKKENIKLKYQVLIYPAVSFDLITKSLYDNGEGFFLTR
EHIDWFGQQYLRSFADLLDFRFSPILADLNDLPPALIITAEHDPLRDQGE
AYANKLLQSGVQVTSVRFNNVIHGFVSFFPFIEQGRDAIGLIGYVLRKVF
YGK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIDPKIKKLLESTIQLPIGKASVEEIRSLFKQFSSLTPREEVGKIEDITI
PGSETNIKARVYYPKTQGPYGVLVYYHGGGFVLGDIESYDPLCRAITNSC
QCVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFNGKYGIAVGGDS
AGGNLAAVTAILSKKENIKLKYQVLIYPAVSFDLITKSLYDNGEGFFLTR
EHIDWFGQQYLRSFADLLDFRFSPILADLNDLPPALIITAEHDPLRDQGE
AYANKLLQSGVQVTSVRFNNVIHGFVSFFPFIEQGRDAIGLIGYVLRKVF
YGK


References
1 more
    Title: Structure and stability of a thermostable carboxylesterase from the thermoacidophilic archaeon Sulfolobus tokodaii.
    Angkawidjaja C, Koga Y, Takano K, Kanaya S
    Ref: Febs J, 279:3071, 2012 : PubMed

            

    Title: A novel thermostable esterase from the thermoacidophilic archaeon Sulfolobus tokodaii strain 7
    Suzuki Y, Miyamoto K, Ohta H
    Ref: FEMS Microbiology Letters, 236:97, 2004 : PubMed

            

    Title: Complete genome sequence of an aerobic thermoacidophilic crenarchaeon, Sulfolobus tokodaii strain7
    Kawarabayasi Y, Hino Y, Horikawa H, Jin-no K, Takahashi M, Sekine M, Baba S, Ankai A, Kosugi H and Kikuchi H <20 more author(s)>
    Ref: DNA Research, 8:123, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer