Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sulto-ST1737

Sulfolobus tokodaii putative acylamino-acid-releasing enzyme

Comment
in Pfam-B_106 in Pfam


Relationship
Family|ACPH_Peptidase_S9
Block| X
Position in NCBI Life Tree|Sulfolobus tokodaii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > TACK group: N E > Crenarchaeota: N E > Thermoprotei: N E > Sulfolobales: N E > Sulfolobaceae: N E > Sulfolobus: N E > Sulfolobus tokodaii: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP000987
1 UniProt : Q96ZU8
1 Interpro : Q96ZU8
1 Prodom : Q96ZU8
1 Pfam : Q96ZU8
1 PIRSF : Q96ZU8
1 SUPERFAM : Q96ZU8
Sequence
Graphical view for this peptide sequence: sulto-ST1737
Colored MSA for ACPH_Peptidase_S9 (raw)
MKYEDLFKIKPVLNYDVYNGKIATIIRDEKPVLYVNGEKVQLEGYVEDVD
WINRNKMFITVDPNGSEIRKVYLYDDGKIEKIIDNEFDNVSPHETKEGIL
VISNYDKRTLHLYLYNEGKYIKLSKGEGPVNNYCFNGKYIVYSTGIYDNN
IHVTDLSGNEIHVINIPNSEQELANENCFTSPSSFIFLSNHEDLFKVYEF
DILKGEIRKIKESNYEIFEAIPYKGSIAYVEDMHGDFVLVHEKEIVNEGF
TRTLTVDGDYLYFINSKHDRSADLYRYGKEVERLTDSMSNVKGDFIKPKV
VSYDSNGVRIYALLYEKGDEDKGVVYIHGGPDWECMNNFNPEIQFLLEKG
FKVICPNYRGSTGYGRKFNHLNDRDPGGGELLDVINSVKVLGVKKVAIIG
ASYGGYLTMMAITKFPDLWCSAVAVVPFVNWFTEKKFEREVLQQYDEIKV
GNDENLLKDRSPIFFIDRIKAPLLLLAGENDPRCPAEETLQVVEELKKLG
RKVKYKIYKDEGHGFAKMENYVDSIRETVEFISTHC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKYEDLFKIKPVLNYDVYNGKIATIIRDEKPVLYVNGEKVQLEGYVEDVD
WINRNKMFITVDPNGSEIRKVYLYDDGKIEKIIDNEFDNVSPHETKEGIL
VISNYDKRTLHLYLYNEGKYIKLSKGEGPVNNYCFNGKYIVYSTGIYDNN
IHVTDLSGNEIHVINIPNSEQELANENCFTSPSSFIFLSNHEDLFKVYEF
DILKGEIRKIKESNYEIFEAIPYKGSIAYVEDMHGDFVLVHEKEIVNEGF
TRTLTVDGDYLYFINSKHDRSADLYRYGKEVERLTDSMSNVKGDFIKPKV
VSYDSNGVRIYALLYEKGDEDKGVVYIHGGPDWECMNNFNPEIQFLLEKG
FKVICPNYRGSTGYGRKFNHLNDRDPGGGELLDVINSVKVLGVKKVAIIG
ASYGGYLTMMAITKFPDLWCSAVAVVPFVNWFTEKKFEREVLQQYDEIKV
GNDENLLKDRSPIFFIDRIKAPLLLLAGENDPRCPAEETLQVVEELKKLG
RKVKYKIYKDEGHGFAKMENYVDSIRETVEFISTHC


Reference
    Title: Complete genome sequence of an aerobic thermoacidophilic crenarchaeon, Sulfolobus tokodaii strain7
    Kawarabayasi Y, Hino Y, Horikawa H, Jin-no K, Takahashi M, Sekine M, Baba S, Ankai A, Kosugi H and Kikuchi H <20 more author(s)>
    Ref: DNA Research, 8:123, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer