Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: symth-q67mr3

Symbiobacterium thermophilum EH96 Esterase LipS from uncultured bacteria

Comment
EH96 promiscuous activity 11/96 substrates Martinez-Martinez et al. 2018. LipS, has significant activity towards Monoacylglycerol Riegler-Berket 2018


Relationship
Family|CarbLipBact_2
Block| X
Position in NCBI Life Tree|Symbiobacterium thermophilum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Clostridia: N E > Clostridiales: N E > Symbiobacteriaceae: N E > Symbiobacterium: N E > Symbiobacterium thermophilum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 4FBL, 4FBM
No kinetic





No Substrate
1 inhbitor:
Spermidine
2 Genbank : JQ028672, AP006840
2 UniProt : Q67MR3, K7QE06
2 Structure : 4FBL, 4FBM
2 UniProt : Q67MR3, K7QE06
2 Interpro : Q67MR3, K7QE06
2 Prodom : Q67MR3, K7QE06
2 Pfam : Q67MR3, K7QE06
2 PIRSF : Q67MR3, K7QE06
2 SUPERFAM : Q67MR3, K7QE06
Sequence
Graphical view for this peptide sequence: symth-q67mr3
Colored MSA for CarbLipBact_2 (raw)
MSRKSRNCRNPPRSGDAQQRPRERSGSGMSTTPLQVLPGAEPLYSVGSRI
GVLVSHGFTGSPQSMRFLAEGFARAGYTVAMPRLTGHGTTPAEMAASTAS
DWTADIVAAMRWLEERCDVLFMTGLSMGGALTVWAAGQFPERFAGIMPIN
AALRMESPDLAALAFNPDAPAELPGIGSDIKAEGVKELAYPVTPVPAIKH
LITIGAVAEMLLPRVKCPALIIQSREDHVVPPHNGELIYNGIGSTEKELL
WLENSYHVATLDNDKELILERSLAFIRKHS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSRKSRNCRNPPRSGDAQQRPRERSGSGMSTTPLQVLPGAEPLYSVGSRI
GVLVSHGFTGSPQSMRFLAEGFARAGYTVAMPRLTGHGTTPAEMAASTAS
DWTADIVAAMRWLEERCDVLFMTGLSMGGALTVWAAGQFPERFAGIMPIN
AALRMESPDLAALAFNPDAPAELPGIGSDIKAEGVKELAYPVTPVPAIKH
LITIGAVAEMLLPRVKCPALIIQSREDHVVPPHNGELIYNGIGSTEKELL
WLENSYHVATLDNDKELILERSLAFIRKHS


References
2 more
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            

    Title: The metagenome-derived enzymes LipS and LipT increase the diversity of known lipases
    Chow J, Kovacic F, Dall Antonia Y, Krauss U, Fersini F, Schmeisser C, Lauinger B, Bongen P, Pietruszka J and Streit WR <8 more author(s)>
    Ref: PLoS ONE, 7:e47665, 2012 : PubMed

            

    Title: Genome sequence of Symbiobacterium thermophilum, an uncultivable bacterium that depends on microbial commensalism
    Ueda K, Yamashita A, Ishikawa J, Shimada M, Watsuji TO, Morimura K, Ikeda H, Hattori M, Beppu T
    Ref: Nucleic Acids Research, 32:4937, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer