(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Cyanobacteria/Melainabacteria group: NE > Cyanobacteria: NE > Synechococcales: NE > Merismopediaceae: NE > Synechocystis: NE > Synechocystis sp.: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Synechocystis sp. (strain PCC 6803): N, E.
Synechocystis sp. PCC 6803: N, E.
Synechocystis sp. PCC 6803 substr. GT-S: N, E.
Synechocystis sp. PCC 6803 substr. Kazusa: N, E.
Synechocystis sp. PCC 6803 substr. PCC-P: N, E.
Synechocystis sp. PCC 6803 substr. GT-I: N, E.
Synechocystis sp. PCC 6803 substr. PCC-N: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MVAEFPDRHPVVLVHGIYDTRAKFATMVDFLTKGGWSVHCLDLVPNDGST SLALLAEQVKQYIDQKFAPQQPVDLIGFSMGGLVTRYYLQRLGGGERVRR YITISAPNQGTLLGYSLPHQGVREMAWQSDFLRDLNRDCCQLLAGLQVTV IWTPFDLMILPPSSSHLEIGQEIILPVLVHAWMVSDARCLAEVASALAKP LP
References
Title: Complete sequence of the first chimera genome constructed by cloning the whole genome of Synechocystis strain PCC6803 into the Bacillus subtilis 168 genome Watanabe S, Shiwa Y, Itaya M, Yoshikawa H Ref: Journal of Bacteriology, 194:7007, 2012 : PubMed
Genome synthesis of existing or designed genomes is made feasible by the first successful cloning of a cyanobacterium, Synechocystis PCC6803, in Gram-positive, endospore-forming Bacillus subtilis. Whole-genome sequence analysis of the isolate and parental B. subtilis strains provides clues for identifying single nucleotide polymorphisms (SNPs) in the 2 complete bacterial genomes in one cell.
Title: Mutation in a novel gene required for photomixotrophic growth leads to enhanced photoautotrophic growth of Synechocystis sp. PCC 6803 Hihara Y, Ikeuchi M Ref: Photosynth Res', 53:243, 1997 : PubMed
In the glucose-tolerant strain of Synechocystis sp. PCC 6803, we found two types of cells with distinct growth properties. Under photoautotrophic conditions at any light intensity, one type gave larger colonies (designated WL) than the other (designated WS). Notably, the WL cells produced much larger colonies than the WS cells at higher light intensity. In contrast, growth of the WL cells was severely suppressed under mixotrophic conditions with glucose and light, while the WS cells grew normally. A gene which could complement the WL phenotype was obtained from a wild-type genomic library. The gene, designated pmgA, coded for a 23 kDa polypeptide of 204 amino acid residues with no apparent homology to known genes. In the WL genome, the base substitution of T for C at position 193 of pmgA caused replacement of Leu with Phe at position 65 of the product. The phenotype of pmgA disruption mutants was similar to that of the WL cells, indicating that the WS cells expressed a functional pmgA product. By direct sequencing of polymerase chain reaction-amplified pmgA from genomic DNA, it was revealed as an example of microevolution that WL had expelled WS from the photoautotrophic culture of wild-type in our laboratory for a year or so. Mixed culture in liquid also demonstrated that the WL cells increased gradually under photoautotrophic conditions, while they decreased rapidly under photomixotrophic conditions. These results suggest that pmgA product is essential for photomixotrophic growth, whereas it represses photoautotrophic growth. To our knowledge, the WL cells and pmgA-disrupted mutants are the first in cyanobacteria, which shows much improved photosynthetic growth than wild-type especially at high light intensity.
The sequence determination of the entire genome of the Synechocystis sp. strain PCC6803 was completed. The total length of the genome finally confirmed was 3,573,470 bp, including the previously reported sequence of 1,003,450 bp from map position 64% to 92% of the genome. The entire sequence was assembled from the sequences of the physical map-based contigs of cosmid clones and of lambda clones and long PCR products which were used for gap-filling. The accuracy of the sequence was guaranteed by analysis of both strands of DNA through the entire genome. The authenticity of the assembled sequence was supported by restriction analysis of long PCR products, which were directly amplified from the genomic DNA using the assembled sequence data. To predict the potential protein-coding regions, analysis of open reading frames (ORFs), analysis by the GeneMark program and similarity search to databases were performed. As a result, a total of 3,168 potential protein genes were assigned on the genome, in which 145 (4.6%) were identical to reported genes and 1,257 (39.6%) and 340 (10.8%) showed similarity to reported and hypothetical genes, respectively. The remaining 1,426 (45.0%) had no apparent similarity to any genes in databases. Among the potential protein genes assigned, 128 were related to the genes participating in photosynthetic reactions. The sum of the sequences coding for potential protein genes occupies 87% of the genome length. By adding rRNA and tRNA genes, therefore, the genome has a very compact arrangement of protein- and RNA-coding regions. A notable feature on the gene organization of the genome was that 99 ORFs, which showed similarity to transposase genes and could be classified into 6 groups, were found spread all over the genome, and at least 26 of them appeared to remain intact. The result implies that rearrangement of the genome occurred frequently during and after establishment of this species.
