Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: talth-f6lqk7

Talaromyces thermophilus Lipase TTL

Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Talaromyces thermophilus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Trichocomaceae: N E > Thermomyces: N E > Thermomyces dupontii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





7 substrates (e.g. : C8-DGDG, C8-MGDG, CNDE... more)
No inhibitor
2 Genbank : AEE61324, JF414585
1 UniProt : F6LQK7
1 UniProt : F6LQK7
1 Interpro : F6LQK7
1 Prodom : F6LQK7
1 Pfam : F6LQK7
1 PIRSF : F6LQK7
1 SUPERFAM : F6LQK7
Sequence
Graphical view for this peptide sequence: talth-f6lqk7
Colored MSA for Lipase_3 (raw)
MRSSLVLFFVSAWTALASPVRREVSQDLFDQFNLFAQYSAAAYCAKNNDA
PAGANVTCRGSICPEVEKADATFLYSFEDSGVGDVTGFLALDNTNRLIVL
SFRGSRSLENWIGNINLDLKGIDDICSGCKGHDGFTSSWRSVANTLTQQV
QNAVREHPDYRVVFTGHSLGGALATVAGASLRGNGYDIDVFSYGAPRVGN
RAFAEFLTAQTGGTLYRITHTNDIVPRLPPRELGYSHSSPEYWITSGTLV
PVTKNDIVKVEGIDSTDGNNQPNTPDIAAHLWYFGLIGTCL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRSSLVLFFVSAWTALASPVRREVSQDLFDQFNLFAQYSAAAYCAKNNDA
PAGANVTCRGSICPEVEKADATFLYSFEDSGVGDVTGFLALDNTNRLIVL
SFRGSRSLENWIGNINLDLKGIDDICSGCKGHDGFTSSWRSVANTLTQQV
QNAVREHPDYRVVFTGHSLGGALATVAGASLRGNGYDIDVFSYGAPRVGN
RAFAEFLTAQTGGTLYRITHTNDIVPRLPPRELGYSHSSPEYWITSGTLV
PVTKNDIVKVEGIDSTDGNNQPNTPDIAAHLWYFGLIGTCL


References
    Title: Galactolipase activity of Talaromyces thermophilus lipase on galactolipid micelles, monomolecular films and UV-absorbing surface-coated substrate
    Belhaj I, Amara S, Parsiegla G, Sutto-Ortiz P, Sahaka M, Belghith H, Rousset A, Lafont D, Carriere F
    Ref: Biochimica & Biophysica Acta Molecular & Cellular Biology Lipids, 1863:1006, 2018 : PubMed

            

    Title: Engineering of Talaromyces thermophilus lipase by altering its crevice-like binding site for highly efficient biocatalytic synthesis of chiral intermediate of Pregablin
    Ding X, Zheng RC, Tang XL, Zheng YG
    Ref: Bioorg Chem, 77:330, 2018 : PubMed

            

    Title: Gene cloning and molecular characterization of the Talaromyces thermophilus lipase catalyzed efficient hydrolysis and synthesis of esters
    Romdhane IB, Frikha F, Maalej-Achouri I, Gargouri A, Belghith H
    Ref: Gene, 494:112, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer