Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tersp-DBFC

Terrabacter sp hydrolase

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Terrabacter sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micrococcales: N E > Intrasporangiaceae: N E > Terrabacter: N E > Terrabacter sp.: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB004563
1 UniProt : Q8VV91
1 Interpro : Q8VV91
1 Pfam : Q8VV91
1 PIRSF : Q8VV91
1 SUPERFAM : Q8VV91
Sequence
Graphical view for this peptide sequence: tersp-DBFC
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MTLDPITIGKDIQTKDWKIHYNEAGEGHPVVLLHGGGPGATGWSNYSPNI
EALSKHFRVIAPDMPGWGDSDAVDFGTLDHVEAAVQLLDALGIEKAAFVG
NSMGGHTSIRLAAERPDRISHLITMGPPVQMKPFLFGAGGPSEGIKIMYA
AYHDPSPEAMSRLVEIMVYDKERFASPELMKERSEAALKRPEHLANVVAK
IPHAPIPIWVDQAKLGGITAPTLLIHGRDDRVATFEGSLFLNANIPNSRA
VLINRCGHWAQLEHAAEFNRLVTDFVLHN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTLDPITIGKDIQTKDWKIHYNEAGEGHPVVLLHGGGPGATGWSNYSPNI
EALSKHFRVIAPDMPGWGDSDAVDFGTLDHVEAAVQLLDALGIEKAAFVG
NSMGGHTSIRLAAERPDRISHLITMGPPVQMKPFLFGAGGPSEGIKIMYA
AYHDPSPEAMSRLVEIMVYDKERFASPELMKERSEAALKRPEHLANVVAK
IPHAPIPIWVDQAKLGGITAPTLLIHGRDDRVATFEGSLFLNANIPNSRA
VLINRCGHWAQLEHAAEFNRLVTDFVLHN


Reference
    Title: Cloning and characterization of genes involved in the degradation of dibenzofuran by Terrabacter sp. strain DBF63.
    Kasuga K, Nojiri H, Yamane H, Kodama T, Omori T
    Ref: J Ferment Bioeng, 84:387, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer