Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tersp-Q93UV1

Terrabacter sp. DBF63 hydrolase meta cleavage compound hydrolase

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Terrabacter sp. DBF63
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micrococcales: N E > Intrasporangiaceae: N E > Terrabacter: N E > Terrabacter sp. DBF63: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AB054975, AB095015
2 UniProt : Q93UV1, Q83ZF0
2 Interpro : Q93UV1, Q83ZF0
2 Prodom : Q93UV1, Q83ZF0
2 Pfam : Q93UV1, Q83ZF0
2 PIRSF : Q93UV1, Q83ZF0
2 SUPERFAM : Q93UV1, Q83ZF0
Sequence
Graphical view for this peptide sequence: tersp-Q93UV1
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MTSAEGGTAQPQGNSFWVDLLGTEVRYRQASSYRTRSIEAGAGEPVVLLH
GVSGHAETWVRNVAVLGRDFRVHAIDMLGHGFTDKPQIEYSIRALAEHVL
GFLDEIGASRAHLVGQSLGGWVAAFLAVHHPERVASLVSVTGAGLQVDAD
GATLTENVGRQVAEATTKALDTPTREKVRTRLEWLVHDPSVVTDELVETR
YRIYASPDFAATAGDMVAAFTSRPRPEELLTAERLATINCPTLVLWTRQN
PTMPWPVGEAASRIIPDATFRLMEDAGHWPQFEKPAEFHAVVGGFLRSVT
AGRRGGRTDGDGDGGPTDPATNRQRAAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTSAEGGTAQPQGNSFWVDLLGTEVRYRQASSYRTRSIEAGAGEPVVLLH
GVSGHAETWVRNVAVLGRDFRVHAIDMLGHGFTDKPQIEYSIRALAEHVL
GFLDEIGASRAHLVGQSLGGWVAAFLAVHHPERVASLVSVTGAGLQVDAD
GATLTENVGRQVAEATTKALDTPTREKVRTRLEWLVHDPSVVTDELVETR
YRIYASPDFAATAGDMVAAFTSRPRPEELLTAERLATINCPTLVLWTRQN
PTMPWPVGEAASRIIPDATFRLMEDAGHWPQFEKPAEFHAVVGGFLRSVT
AGRRGGRTDGDGDGGPTDPATNRQRAAR


Reference
    Title: Isolation and characterization of the genes encoding a novel oxygenase component of angular dioxygenase from the gram-positive dibenzofuran-degrader Terrabacter sp. strain DBF63
    Kasuga K, Habe H, Chung JS, Yoshida T, Nojiri H, Yamane H, Omori T
    Ref: Biochemical & Biophysical Research Communications, 283:195, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer