tetng-nlgn2a

 
Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) Neuroligin 2a

Relationship
Family Neuroligin
Block C
Tetraodon nigroviridis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Euteleosteomorpha: N E > Neoteleostei: N E > Eurypterygia: N E > Ctenosquamata: N E > Acanthomorphata: N E > Euacanthomorphacea: N E > Percomorphaceae: N E > Eupercaria: N E > Tetraodontiformes: N E > Tetraodontoidei: N E > Tetradontoidea: N E > Tetraodontidae: N E > Tetraodon: N E > Tetraodon nigroviridis: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : GQ489228, CAAE01009425
3 UniProt : D2X2J7, Q4T557, H3CEY5
3 UniProtTrembl : D2X2J7, Q4T557, H3CEY5
3 Interpro : D2X2J7, Q4T557, H3CEY5
3 Prodom : D2X2J7, Q4T557, H3CEY5
3 Pfam : D2X2J7, Q4T557, H3CEY5
3 PIRSF : D2X2J7, Q4T557, H3CEY5
3 SUPERFAM : D2X2J7, Q4T557, H3CEY5
3 QuickSwissBlast : D2X2J7, Q4T557, H3CEY5
 
Sequence
Graphical view for this peptide sequence: tetng-nlgn2a
Colored MSA for Neuroligin (raw)
MADWRLMGAVGLLLVFSLASSQKVDPSKHPIVTTNYGKLRGVKKDLNNEI
LGPVEQYLGVPYATAPIGDRRFQPPEAPGSWQEIRNATQFAPVCPQNIHG
VLPEIMLPVWFTDNLDVAAGYIQNQSEDCLYLNVYVPTEDGPLTKKHDES
SMNKPRDEDIRDRRKKPVMLFIHGGSYMEGTGNMFDASVLAAYGNVIVVT
MNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDPERITI
FGSGAGASCVNLLILSHHSEGLFHRAIAQSGTAISSWSVNYQPLKYTKIL
ARKVGCTYAETADLVDCLRRKNFRELVDQDIQPARYHIAFGPVVDGDVVP
DDPEILMQQGEFLNYDILIGVNQGEGLKFVDDSEDNDGISAAAFDYTISN
FVDNLYGYPEGKDILRETIKFMYTDWADRDNGDMRRKTLLALFTDHQWVA
PAVATAKLHAEFQSPVYFYTFYHHCQTETRPEWADAAHGDEIPYVFGVPM
IGATDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNLPVPQDTKFIHTKP
NRFEEVIWTKFNSKDKQYLHIGLKPRVRDNYRANKVAFWLELVPHLHSLH
EELFPTTTRSPAGPGPGTHRPWPRTPGPRTTRHPYPTFPSDPEPEGSERP
HQNLFPGDTRDYSTELSVTVAVGASLLFLNILAFAALYYKRDKRHEMRRH
RLSPQRGGPANDLAHSQEEEIMSLQMKHSEHDAHHDLEPLRPHDILRPAC
PPDYTLALRRAPDDVPLMTPNTITMIPSTITSMQPLHAFNTFPSTGHNNT
LPHPHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MADWRLMGAVGLLLVFSLASSQKVDPSKHPIVTTNYGKLRGVKKDLNNEI
LGPVEQYLGVPYATAPIGDRRFQPPEAPGSWQEIRNATQFAPVCPQNIHG
VLPEIMLPVWFTDNLDVAAGYIQNQSEDCLYLNVYVPTEDGPLTKKHDES
SMNKPRDEDIRDRRKKPVMLFIHGGSYMEGTGNMFDASVLAAYGNVIVVT
MNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDPERITI
FGSGAGASCVNLLILSHHSEGLFHRAIAQSGTAISSWSVNYQPLKYTKIL
ARKVGCTYAETADLVDCLRRKNFRELVDQDIQPARYHIAFGPVVDGDVVP
DDPEILMQQGEFLNYDILIGVNQGEGLKFVDDSEDNDGISAAAFDYTISN
FVDNLYGYPEGKDILRETIKFMYTDWADRDNGDMRRKTLLALFTDHQWVA
PAVATAKLHAEFQSPVYFYTFYHHCQTETRPEWADAAHGDEIPYVFGVPM
IGATDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNLPVPQDTKFIHTKP
NRFEEVIWTKFNSKDKQYLHIGLKPRVRDNYRANKVAFWLELVPHLHSLH
EELFPTTTRSPAGPGPGTHRPWPRTPGPRTTRHPYPTFPSDPEPEGSERP
HQNLFPGDTRDYSTELSVTVAVGASLLFLNILAFAALYYKRDKRHEMRRH
RLSPQRGGPANDLAHSQEEEIMSLQMKHSEHDAHHDLEPLRPHDILRPAC
PPDYTLALRRAPDDVPLMTPNTITMIPSTITSMQPLHAFNTFPSTGHNNT
LPHPHSTTRV

no DNA




References
    Title: Characterization of the neuroligin gene family expression and evolution in zebrafish
    Rissone A, Sangiorgio L, Monopoli M, Beltrame M, Zucchi I, Bussolino F, Arese M, Cotelli F
    Ref: Developmental Dynamics, 239:688, 2010 : PubMed

            

    Title: Genome duplication in the teleost fish Tetraodon nigroviridis reveals the early vertebrate proto-karyotype
    Jaillon O, Aury JM, Brunet F, Petit JL, Stange-Thomann N, Mauceli E, Bouneau L, Fischer C, Ozouf-Costaz C and Roest Crollius H <51 more author(s)>
    Ref: Nature, 431:946, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer