Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tetts-q23d68

Tetrahymena thermophila SB210 hypothetical protein

Comment
only c-term PfamA DUF676 523 717


Relationship
Family|Duf_676
Block| X
Position in NCBI Life Tree|Tetrahymena thermophila SB210
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Alveolata: N E > Ciliophora: N E > Intramacronucleata: N E > Oligohymenophorea: N E > Hymenostomatida: N E > Tetrahymenina: N E > Tetrahymenidae: N E > Tetrahymena: N E > Tetrahymena thermophila: N E > Tetrahymena thermophila SB210: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CH445663
1 UniProt : Q23D68
1 UniProt : Q23D68
1 Interpro : Q23D68
1 Pfam : Q23D68
1 PIRSF : Q23D68
1 SUPERFAM : Q23D68
Sequence
Graphical view for this peptide sequence: tetts-q23d68
Colored MSA for Duf_676 (raw)
NIYYKGIHLFVLVHGFQGNAYDMKMLKNYLNYMHPEAMFLCSVYNEDNTE
GDIDEMGKNLANEIQTFIADNCSGENLGRISLIGFSLGGVIIRSALPMLE
EYSEKMYTFMSLSSPHLGFMYNPNKIIEAGIWILKRWKKSTSLQQLTMAD
SKDIENTFLYRLSKAKGLGWFKNVCLVSSYQDSYAPFDSARIEMTKEAMK
DAYLFNQKPFKKQIQTFFYFQIQRKGKLYNEMTQNILSQLSTNSLHRLDV
HFHIQEKILVQNYDTFFR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

NIYYKGIHLFVLVHGFQGNAYDMKMLKNYLNYMHPEAMFLCSVYNEDNTE
GDIDEMGKNLANEIQTFIADNCSGENLGRISLIGFSLGGVIIRSALPMLE
EYSEKMYTFMSLSSPHLGFMYNPNKIIEAGIWILKRWKKSTSLQQLTMAD
SKDIENTFLYRLSKAKGLGWFKNVCLVSSYQDSYAPFDSARIEMTKEAMK
DAYLFNQKPFKKQIQTFFYFQIQRKGKLYNEMTQNILSQLSTNSLHRLDV
HFHIQEKILVQNYDTFFR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer