Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tetur-t1jrk9

Tetranychus urticae (Two-spotted spider mite). Uncharacterized protein

Relationship
Family|Pancreatic_lipase
Block| L
Position in NCBI Life Tree|Tetranychus urticae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Chelicerata: N E > Arachnida: N E > Acari: N E > Acariformes: N E > Trombidiformes: N E > Prostigmata: N E > Eleutherengona: N E > Raphignathae: N E > Tetranychoidea: N E > Tetranychidae: N E > Tetranychus: N E > Tetranychus urticae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CAEY01000449
1 UniProt : T1JRK9
1 UniProt : T1JRK9
1 Interpro : T1JRK9
1 Pfam : T1JRK9
1 PIRSF : T1JRK9
1 SUPERFAM : T1JRK9
Sequence
Graphical view for this peptide sequence: tetur-t1jrk9
Colored MSA for Pancreatic_lipase (raw)
MNKFILISFLIIFNCGFAVSHINNETVKTIFEIIAPYFRIDRLQVFKGPK
CFSDLGCFENRQTFQHPIFRPISLSPEEPEKIETRFFLYSKPGQIVPQLI
NHNNITRSNFNPKLRTIFAVHGFYYANYLGQYQIESFRKLKKALFIKENI
NYIFVDWGKGASTWYVQATANTRVVGAQLAQLVEKIILNFGVSKNKIWLI
GHSLGAHVVGYAGSIVKNIGRITGLDPAKPYFVGMPNEVRLDAGDALFVD
VIHTNAPQISQPFGFGTRQILGHVDFYPNGGNNQPGCIKEEIAGFFESLQ
YGLQKTSICNHERSIQMLASAIDVSNCEMIAHKCDSFLDFKQGSCYLCGP
DGQNCEIINNPRPGHQQNQRYFLLTNSEPPFCVHHYRISIHLGDLPASIK
QMVIFHLNLTSSGAKAFGHSEKISLKSHASSAFLITGDRLIEDQNLMLEL
FIESEFHPGTINISHLEITPIQI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNKFILISFLIIFNCGFAVSHINNETVKTIFEIIAPYFRIDRLQVFKGPK
CFSDLGCFENRQTFQHPIFRPISLSPEEPEKIETRFFLYSKPGQIVPQLI
NHNNITRSNFNPKLRTIFAVHGFYYANYLGQYQIESFRKLKKALFIKENI
NYIFVDWGKGASTWYVQATANTRVVGAQLAQLVEKIILNFGVSKNKIWLI
GHSLGAHVVGYAGSIVKNIGRITGLDPAKPYFVGMPNEVRLDAGDALFVD
VIHTNAPQISQPFGFGTRQILGHVDFYPNGGNNQPGCIKEEIAGFFESLQ
YGLQKTSICNHERSIQMLASAIDVSNCEMIAHKCDSFLDFKQGSCYLCGP
DGQNCEIINNPRPGHQQNQRYFLLTNSEPPFCVHHYRISIHLGDLPASIK
QMVIFHLNLTSSGAKAFGHSEKISLKSHASSAFLITGDRLIEDQNLMLEL
FIESEFHPGTINISHLEITPIQI



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer