thecd-d1a2h1

 
Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081). Triacylglycerol lipase Tcur0390 TcCut0390

Comment
Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081)


Relationship
Block L
Thermomonospora curvata position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptosporangiales: N E > Thermomonosporaceae: N E > Thermomonospora: N E > Thermomonospora curvata: N E

Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: Polyurethane ,

2 Genbank : CP001738, ACY95991
1 UniProt : D1A2H1
1 UniProtTrembl : D1A2H1
1 Interpro : D1A2H1
1 Prodom : D1A2H1
1 Pfam : D1A2H1
1 PIRSF : D1A2H1
1 SUPERFAM : D1A2H1
1 QuickSwissBlast : D1A2H1
 
Sequence
Graphical view for this peptide sequence: thecd-d1a2h1
Colored MSA for Polyesterase-lipase-cutinase (raw)
MKRTLKRALSLLPAAALAASALVAASPAQAAANPYQRGPNPTEASITAAR
GPFNTAEITVSRLSVSGFGGGKIYYPTTTSEGTFGAIAISPGFTAYWSSL
EWLGHRLASQGFVVIGIETNTTLDQPDQRGQQLLAALDYLTQRSAVRDRV
DASRLAVAGHSMGGGGSLEAAKARTSLKAAIPLAPWNLDKTWPEVRTPTL
IIGGELDAVAPVATHSIPFYNSLSNAPEKAYLELDNASHFFPNITNTQMA
KYMIAWMKRFIDDDTRYTQFLCPPPSTGLLSDFSDARFTCPM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKRTLKRALSLLPAAALAASALVAASPAQAAANPYQRGPNPTEASITAAR
GPFNTAEITVSRLSVSGFGGGKIYYPTTTSEGTFGAIAISPGFTAYWSSL
EWLGHRLASQGFVVIGIETNTTLDQPDQRGQQLLAALDYLTQRSAVRDRV
DASRLAVAGHSMGGGGSLEAAKARTSLKAAIPLAPWNLDKTWPEVRTPTL
IIGGELDAVAPVATHSIPFYNSLSNAPEKAYLELDNASHFFPNITNTQMA
KYMIAWMKRFIDDDTRYTQFLCPPPSTGLLSDFSDARFTCPM

no DNA




References
1 more
    Title: Degradation of Polyester Polyurethane by Bacterial Polyester Hydrolases
    Schmidt J, Wei R, Oeser T, Dedavid e Silva LA, Breite D, Schulze A, Zimmermann W
    Ref: Polymers (Basel), 9:65, 2017 : PubMed

            

    Title: Functional characterization and structural modeling of synthetic polyester-degrading hydrolases from Thermomonospora curvata
    Wei R, Oeser T, Then J, Kuhn N, Barth M, Schmidt J, Zimmermann W
    Ref: AMB Express, 4:44, 2014 : PubMed

            

    Title: Complete genome sequence of Thermomonospora curvata type strain (B9)
    Chertkov O, Sikorski J, Nolan M, Lapidus A, Lucas S, Del Rio TG, Tice H, Cheng JF, Goodwin L and Kyrpides NC <25 more author(s)>
    Ref: Stand Genomic Sci, 4:13, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer