Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: thecd-d1aat5

Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081) Cutinase

Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Thermomonospora curvata
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptosporangiales: N E > Thermomonosporaceae: N E > Thermomonospora: N E > Thermomonospora curvata: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP001738
1 UniProt : D1AAT5
1 UniProt : D1AAT5
1 Interpro : D1AAT5
1 Prodom : D1AAT5
1 Pfam : D1AAT5
1 PIRSF : D1AAT5
1 SUPERFAM : D1AAT5
Sequence
Graphical view for this peptide sequence: thecd-d1aat5
Colored MSA for Cutinase (raw)
MRSRTSTLARLVATVTALTGAATGGLVALGAAPASAACSPVEVVAARGTF
EPGRLGVIVGDPVFKALQGRFPKKKLSAHPVDYPADASPTSPRKGVQALV
KHVTKQARACPKQKFVLVGYSQGAMVVTGALGGAVGGGTKLPKNTHAKIA
AILLFGNPNRMAGKSGVAKKFAGRTLDICKKGDPVCGGGTNMAAHLAYRS
DADRAARFAAEKIRKR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRSRTSTLARLVATVTALTGAATGGLVALGAAPASAACSPVEVVAARGTF
EPGRLGVIVGDPVFKALQGRFPKKKLSAHPVDYPADASPTSPRKGVQALV
KHVTKQARACPKQKFVLVGYSQGAMVVTGALGGAVGGGTKLPKNTHAKIA
AILLFGNPNRMAGKSGVAKKFAGRTLDICKKGDPVCGGGTNMAAHLAYRS
DADRAARFAAEKIRKR


Reference
    Title: Complete genome sequence of Thermomonospora curvata type strain (B9)
    Chertkov O, Sikorski J, Nolan M, Lapidus A, Lucas S, Del Rio TG, Tice H, Cheng JF, Goodwin L and Kyrpides NC <25 more author(s)>
    Ref: Stand Genomic Sci, 4:13, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer