thefu-1831

 
Thermobifida fusca putative carboxylesterase TfCa

Comment
Other strains: Thermobifida fusca (Tfus_37; YX; KW3; TM51) Carboxylesterase TfCa


Relationship
Block C
Thermobifida fusca position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptosporangiales: N E > Nocardiopsaceae: N E > Thermobifida: N E > Thermobifida fusca: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: 2PET , Diethyl-terephthalate ,

>3 Genbank links 1 more: NZ_AAAQ01000037, CP000088, FN401519
3 UniProt : Q47M62, P86325, C5JAB7
1 Ncbi-nid : 23018727
1 Ncbi-pid : 23018749
3 UniProtTrembl : Q47M62, P86325, C5JAB7
3 Interpro : Q47M62, P86325, C5JAB7
3 Prodom : Q47M62, P86325, C5JAB7
3 Pfam : Q47M62, P86325, C5JAB7
3 PIRSF : Q47M62, P86325, C5JAB7
3 SUPERFAM : Q47M62, P86325, C5JAB7
3 QuickSwissBlast : Q47M62, P86325, C5JAB7
 
Sequence
Graphical view for this peptide sequence: thefu-1831
Colored MSA for Carb_B_Bacteria (raw)
MANEKSSRVPLDITHPALLGRNRLVGKERGKCVEIVIRTGSGDVRGSKEN
GIAVFRGIPYAEPPVGAHRFTAPRPPRPWDGVRDATEFSATAPRPPYPEA
IGALLIERFIPGDDYLTLNVWTPDPNAVGLPVMVWIHGGAFTNGSGSEPV
YDGAAFARDGVVFVSFNYRLGIIGFADLPDAPSNRGLLDQIAALEWVRDN
IARFGGDPGNVTVFGESAGAMSVCTLMATPRARGLFRRAILQSGAGNMAV
AAEDATTIAAVIAHRLGVEPTAAALAHVPVAQLLDVQQQVAQEIQGAPDP
AVWGERIAGGSVLLPFAPVIDGELLSQRPAEAIAGGAGHDVDLLFGTTTD
EYRLFLAPTGLLPFITGDYVTTHLAKSGLDADAAKAYTAEGRGEEPGDIL
ASIITDQVFRIPALRIAESRVDAPARTFGYEFAWRTPQLDGILGACHAVE
LPFVFRTLDRAASLVGTNPPEELAETVHNAWVRFATSGDPGWPAWNPETR
SVMRFDHPVSEMVTDPYPATRALWDGVPL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MANEKSSRVPLDITHPALLGRNRLVGKERGKCVEIVIRTGSGDVRGSKEN
GIAVFRGIPYAEPPVGAHRFTAPRPPRPWDGVRDATEFSATAPRPPYPEA
IGALLIERFIPGDDYLTLNVWTPDPNAVGLPVMVWIHGGAFTNGSGSEPV
YDGAAFARDGVVFVSFNYRLGIIGFADLPDAPSNRGLLDQIAALEWVRDN
IARFGGDPGNVTVFGESAGAMSVCTLMATPRARGLFRRAILQSGAGNMAV
AAEDATTIAAVIAHRLGVEPTAAALAHVPVAQLLDVQQQVAQEIQGAPDP
AVWGERIAGGSVLLPFAPVIDGELLSQRPAEAIAGGAGHDVDLLFGTTTD
EYRLFLAPTGLLPFITGDYVTTHLAKSGLDADAAKAYTAEGRGEEPGDIL
ASIITDQVFRIPALRIAESRVDAPARTFGYEFAWRTPQLDGILGACHAVE
LPFVFRTLDRAASLVGTNPPEELAETVHNAWVRFATSGDPGWPAWNPETR
SVMRFDHPVSEMVTDPYPATRALWDGVPL

Graphical view for this nucleotide DNA sequence (1634 bp): thefu-1831



References
2 more
    Title: Perspectives on the Role of Enzymatic Biocatalysis for the Degradation of Plastic PET
    Magalhaes RP, Cunha JM, Sousa SF
    Ref: Int J Mol Sci, 22:11257, 2021 : PubMed

            

    Title: Draft Genome Sequence of the Lignocellulose Decomposer Thermobifida fusca Strain TM51
    Toth A, Barna T, Nagy I, Horvath B, Tancsics A, Kriszt B, Baka E, Fekete C, Kukolya J
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: High level expression of a hydrophobic poly(ethylene terephthalate)-hydrolyzing carboxylesterase from Thermobifida fusca KW3 in Escherichia coli BL21(DE3)
    Oeser T, Wei R, Baumgarten T, Billig S, Follner C, Zimmermann W
    Ref: J Biotechnol, 146:100, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer